Protein Family IF05276
Metagenome
Isolate
139
Members
50
Samples
128
Scaffolds
117.37
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_036581|Ga0466699_036581_1616_2026
- Length
- 136 aa
- Sequence
- VLFEQVFYLPCLEVAMADVHSDIPEDDDFDTILSPDIDFSGTLNFEKPFLIRGKVSGEISARGLLVVDEEAVVNASIDASRVVIRGFVKGDVIAAEKVEVSLTGRLEGNITAPEIFMETGCVFNGRCTMDEKNAVL
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.6%
Kalotermitidae
25.0%
Unclassified
22.9%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Blaberidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 3 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 4 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 10 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 29 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 30 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 37 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11057874 | 3300010049 | Bacteria | 981 |
| 2 | Ga0123353_11080703 | 3300010167 | Bacteria | 1068 |
| 3 | Ga0466692_188875 | 3300042591 | Bacteria | 3049 |
| 4 | Ga0466694_132841 | 3300042594 | Bacteria | 23900 |
| 5 | Ga0466694_214797 | 3300042594 | Bacteria | 1246 |
| 6 | Ga0466699_036581 | 3300042597 | Bacteria | 2057 |
| 7 | Ga0466699_332337 | 3300042597 | Bacteria | 18397 |
| 8 | Ga0466699_366774 | 3300042597 | Bacteria | 1802 |
| 9 | Ga0466712_014264 | 3300042614 | Bacteria | 1587 |
| 10 | Ga0466712_255105 | 3300042614 | Bacteria | 6117 |
| 11 | Ga0466723_232345 | 3300042618 | Bacteria | 8684 |
| 12 | Ga0466728_051412 | 3300042620 | Bacteria | 14414 |
| 13 | JGI24698J34947_10012818 | 3300002449 | Bacteria | 4586 |
| 14 | JGI24698J34947_10125748 | 3300002449 | Bacteria | 1105 |
| 15 | Ga0466701_044573 | 3300042598 | Bacteria | 3063 |
| 16 | Ga0466700_053087 | 3300042600 | Bacteria | 1166 |
| 17 | Ga0466719_286417 | 3300042606 | Bacteria | 62956 |
| 18 | Ga0466708_098571 | 3300042652 | Bacteria | 11631 |
| 19 | Ga0466727_283597 | 3300042655 | Bacteria | 3360 |
| 20 | Ga0466699_051925 | 3300042597 | Bacteria | 1658 |
| 21 | Ga0466715_207901 | 3300042616 | Bacteria | 5815 |
| 22 | Ga0466715_314772 | 3300042616 | Bacteria | 6853 |
| 23 | Ga0466718_071543 | 3300042617 | Bacteria | 3392 |
| 24 | Ga0466726_291138 | 3300042619 | Bacteria | 1349 |
| 25 | Ga0466726_385489 | 3300042619 | Bacteria | 2465 |
| 26 | Ga0466716_479574 | 3300042605 | Bacteria | 1164 |
| 27 | Ga0466698_472331 | 3300042610 | Bacteria | 5792 |
| 28 | Ga0466731_392619 | 3300042622 | Bacteria | 1472 |
| 29 | Ga0466732_167953 | 3300042656 | Bacteria | 21343 |
| 30 | Ga0123353_11094922 | 3300010167 | Bacteria | 1058 |
| 31 | Ga0466694_044693 | 3300042594 | Bacteria | 2809 |
| 32 | Ga0466699_190139 | 3300042597 | Bacteria | 4915 |
| 33 | Ga0466712_131861 | 3300042614 | Bacteria | 1056 |
| 34 | Ga0466712_251346 | 3300042614 | Bacteria | 1303 |
| 35 | Ga0466718_037548 | 3300042617 | Bacteria | 3154 |
| 36 | JGI24698J34947_10067150 | 3300002449 | Bacteria | 1742 |
| 37 | Ga0466706_005453 | 3300042599 | Bacteria | 1094 |
| 38 | Ga0466707_409074 | 3300042601 | Bacteria | 2368 |
| 39 | Ga0466717_202440 | 3300042604 | Bacteria | 1076 |
| 40 | Ga0466719_084428 | 3300042606 | Bacteria | 3240 |
| 41 | Ga0466702_043442 | 3300042635 | Bacteria | 1647 |
| 42 | Ga0466703_100634 | 3300042636 | Bacteria | 15896 |
| 43 | Ga0466704_589498 | 3300042643 | Bacteria | 4311 |
| 44 | Ga0466727_228847 | 3300042655 | Bacteria | 1987 |
| 45 | Ga0466690_225757 | 3300042590 | Bacteria | 1185 |
| 46 | Ga0466699_280779 | 3300042597 | Bacteria | 1433 |
| 47 | Ga0466699_425511 | 3300042597 | Bacteria | 4340 |
| 48 | Ga0466718_028898 | 3300042617 | Unclassified | 1701 |
| 49 | Ga0466718_102965 | 3300042617 | Bacteria | 23414 |
| 50 | Ga0466718_162543 | 3300042617 | Unclassified | 4155 |
| 51 | Ga0466706_226749 | 3300042599 | Bacteria | 1306 |
| 52 | Ga0466719_082788 | 3300042606 | Bacteria | 10904 |
| 53 | Ga0466720_054578 | 3300042607 | Bacteria | 2297 |
| 54 | Ga0466720_132687 | 3300042607 | Bacteria | 4252 |
| 55 | Ga0466720_222761 | 3300042607 | Bacteria | 1774 |
| 56 | Ga0466705_377809 | 3300042612 | Bacteria | 1650 |
| 57 | Ga0466704_219861 | 3300042643 | Bacteria | 10698 |
| 58 | Ga0466696_163838 | 3300042596 | Bacteria | 5103 |
| 59 | Ga0466696_230089 | 3300042596 | Bacteria | 2052 |
| 60 | Ga0466699_252611 | 3300042597 | Bacteria | 1050 |
| 61 | Ga0466712_006862 | 3300042614 | Bacteria | 8984 |
| 62 | Ga0466718_126838 | 3300042617 | Bacteria | 1817 |
| 63 | Ga0466726_356407 | 3300042619 | Bacteria | 7219 |
| 64 | Ga0466728_134418 | 3300042620 | Bacteria | 11908 |
| 65 | Ga0466728_150854 | 3300042620 | Bacteria | 3167 |
| 66 | Ga0466728_396412 | 3300042620 | Bacteria | 1629 |
| 67 | JGI24698J34947_10097822 | 3300002449 | Bacteria | 1327 |
| 68 | JGI24698J34947_10136120 | 3300002449 | Bacteria | 1042 |
| 69 | JGI24698J34947_10301516 | 3300002449 | Bacteria | 577 |
| 70 | Ga0466706_278724 | 3300042599 | Bacteria | 2903 |
| 71 | Ga0466700_093471 | 3300042600 | Bacteria | 1279 |
| 72 | Ga0466720_191201 | 3300042607 | Bacteria | 58294 |
| 73 | Ga0466722_116984 | 3300042609 | Bacteria | 14081 |
| 74 | Ga0466703_063344 | 3300042636 | Bacteria | 9597 |
| 75 | Ga0466704_229804 | 3300042643 | Bacteria | 6568 |
| 76 | Ga0466732_449228 | 3300042656 | Bacteria | 1042 |
| 77 | Ga0123353_10710133 | 3300010167 | Bacteria | 1409 |
| 78 | Ga0466694_348101 | 3300042594 | Bacteria | 2041 |
| 79 | Ga0466699_271116 | 3300042597 | Bacteria | 1172 |
| 80 | Ga0466699_276868 | 3300042597 | Bacteria | 1991 |
| 81 | Ga0466712_268881 | 3300042614 | Bacteria | 14662 |
| 82 | Ga0466718_110535 | 3300042617 | Bacteria | 2259 |
| 83 | Ga0466718_127806 | 3300042617 | Bacteria | 4033 |
| 84 | Ga0466726_414922 | 3300042619 | Bacteria | 1214 |
| 85 | JGI24698J34947_10254373 | 3300002449 | Bacteria | 654 |
| 86 | Ga0072940_1019611 | 3300005200 | Bacteria | 11713 |
| 87 | Ga0072941_1032660 | 3300005201 | Bacteria | 8642 |
| 88 | Ga0466719_376908 | 3300042606 | Bacteria | 2773 |
| 89 | Ga0466722_163467 | 3300042609 | Bacteria | 8234 |
| 90 | Ga0466705_018356 | 3300042612 | Bacteria | 3332 |
| 91 | Ga0466703_238979 | 3300042636 | Bacteria | 3935 |
| 92 | Ga0466704_214300 | 3300042643 | Bacteria | 4878 |
| 93 | Ga0466704_248323 | 3300042643 | Bacteria | 12844 |
| 94 | Ga0466708_144884 | 3300042652 | Bacteria | 5358 |
| 95 | Ga0466708_357611 | 3300042652 | Bacteria | 4572 |
| 96 | Ga0123356_10494642 | 3300010049 | Bacteria | 1378 |
| 97 | Ga0466699_015663 | 3300042597 | Bacteria | 3229 |
| 98 | Ga0466699_327204 | 3300042597 | Bacteria | 12319 |
| 99 | Ga0466718_026606 | 3300042617 | Bacteria | 1477 |
| 100 | Ga0466718_034398 | 3300042617 | Bacteria | 9536 |
| 101 | Ga0466728_028718 | 3300042620 | Bacteria | 1464 |
| 102 | AustNasuHG_c1000681 | 3300000089 | Bacteria | 12073 |
| 103 | JGI24698J34947_10026597 | 3300002449 | Bacteria | 3074 |
| 104 | JGI24698J34947_10050311 | 3300002449 | Unclassified | 2103 |
| 105 | Ga0466716_325483 | 3300042605 | Bacteria | 8111 |
| 106 | Ga0466698_419888 | 3300042610 | Bacteria | 1054 |
| 107 | Ga0466705_268799 | 3300042612 | Bacteria | 2003 |
| 108 | Ga0466705_269285 | 3300042612 | Bacteria | 2927 |
| 109 | Ga0466704_494107 | 3300042643 | Unclassified | 5059 |
| 110 | Ga0466709_316887 | 3300042648 | Bacteria | 3116 |
| 111 | Ga0466732_305882 | 3300042656 | Unclassified | 2598 |
| 112 | Ga0264413_117474 | 3300024493 | Bacteria | 7582 |
| 113 | Ga0466692_013287 | 3300042591 | Unclassified | 1769 |
| 114 | Ga0466694_050111 | 3300042594 | Bacteria | 44560 |
| 115 | Ga0466694_169100 | 3300042594 | Bacteria | 1778 |
| 116 | Ga0466695_106345 | 3300042595 | Bacteria | 8476 |
| 117 | Ga0466696_335385 | 3300042596 | Bacteria | 14530 |
| 118 | Ga0466699_351856 | 3300042597 | Unclassified | 1007 |
| 119 | Ga0466712_091972 | 3300042614 | Bacteria | 1207 |
| 120 | Ga0466715_063901 | 3300042616 | Bacteria | 8520 |
| 121 | Ga0466718_013225 | 3300042617 | Bacteria | 1655 |
| 122 | Ga0074263_130373 | 3300005485 | Bacteria | 911 |
| 123 | Ga0466707_190391 | 3300042601 | Bacteria | 2352 |
| 124 | Ga0466719_017146 | 3300042606 | Bacteria | 1389 |
| 125 | Ga0466720_034318 | 3300042607 | Bacteria | 32841 |
| 126 | Ga0466705_281907 | 3300042612 | Bacteria | 1918 |
| 127 | Ga0466704_066200 | 3300042643 | Bacteria | 10680 |
| 128 | Ga0466704_332431 | 3300042643 | Bacteria | 1049 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04519 | Bactofilin | Polymer-forming cytoskeletal | 31 | 127 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.