Protein Family IF05231
Metagenome
Isolate
111
Members
53
Samples
103
Scaffolds
142.13
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_365629|Ga0466696_365629_381_890
- Length
- 169 aa
- Sequence
- MRQQTVYDCSFIELTRIENRSGNITPVTGNINLPFDVKRIFYTYDIPGGESRGAHAHKECHQFLVAASGSFEVALDDSVNKRTVLLNRPFYGLHIPPRIWAAEQGFSSGSVCLVLASHKYDAEDYIRDYREYLYYINLMLENVNGWGGVIPEPQIVVRLHCCIIKKEAA
Sample Types
Isolate
6.3%
Metagenome
93.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
24.5%
Elmidae
6.1%
Unclassified
6.1%
Termopsidae
6.1%
Armadillidiidae
4.1%
Tenebrionidae
2.0%
Drosophilidae
2.0%
Passalidae
2.0%
Rhinotermitidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 2 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 8 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 15 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 16 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 34 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 35 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 36 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10057080 | 3300010167 | Unclassified | 6252 |
| 2 | Ga0123354_10002062 | 3300010882 | Bacteria | 25930 |
| 3 | Ga0466690_086134 | 3300042590 | Bacteria | 1943 |
| 4 | Ga0466707_402486 | 3300042601 | Bacteria | 63652 |
| 5 | IMNBL1DRAFT_c0122109 | 3300000062 | Bacteria | 684 |
| 6 | Ga0466715_223102 | 3300042616 | Bacteria | 1614 |
| 7 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 8 | Ga0466704_083571 | 3300042643 | Bacteria | 2852 |
| 9 | Ga0466727_089473 | 3300042655 | Bacteria | 2364 |
| 10 | Ga0466733_003165 | 3300042659 | Bacteria | 1972 |
| 11 | Ga0160430_101997 | 3300012852 | Bacteria | 6844 |
| 12 | Ga0466692_076310 | 3300042591 | Bacteria | 1662 |
| 13 | Ga0466706_091702 | 3300042599 | Bacteria | 10085 |
| 14 | JGI24702J35022_10378831 | 3300002462 | Bacteria | 851 |
| 15 | JGI24705J35276_12238649 | 3300002504 | Unclassified | 32309 |
| 16 | JGI24696J40584_12705012 | 3300002834 | Archaea | 742 |
| 17 | JGI24696J40584_12955997 | 3300002834 | Bacteria | 2986 |
| 18 | JGI24696J40584_12960532 | 3300002834 | Bacteria | 7507 |
| 19 | Ga0104045_1001935 | 3300007085 | Bacteria | 2034 |
| 20 | Ga0466726_177553 | 3300042619 | Bacteria | 1356 |
| 21 | Ga0466731_021559 | 3300042622 | Bacteria | 14604 |
| 22 | Ga0466734_106374 | 3300042623 | Bacteria | 1932 |
| 23 | Ga0466735_083574 | 3300042624 | Bacteria | 1023 |
| 24 | Ga0466704_191570 | 3300042643 | Bacteria | 13216 |
| 25 | Ga0466704_455185 | 3300042643 | Bacteria | 13915 |
| 26 | Ga0466709_005524 | 3300042648 | Bacteria | 140810 |
| 27 | Ga0466708_432714 | 3300042652 | Bacteria | 1592 |
| 28 | Ga0466727_196127 | 3300042655 | Bacteria | 1479 |
| 29 | Ga0123356_10574625 | 3300010049 | Bacteria | 1290 |
| 30 | Ga0123354_10000079 | 3300010882 | Bacteria | 73211 |
| 31 | Ga0466690_057160 | 3300042590 | Bacteria | 1875 |
| 32 | Ga0466690_231363 | 3300042590 | Bacteria | 3993 |
| 33 | Ga0466692_193931 | 3300042591 | Bacteria | 2550 |
| 34 | Ga0466691_196830 | 3300042593 | Bacteria | 2103 |
| 35 | Ga0466711_116900 | 3300042615 | Bacteria | 2175 |
| 36 | Ga0466728_435243 | 3300042620 | Bacteria | 3832 |
| 37 | Ga0466735_018978 | 3300042624 | Bacteria | 7825 |
| 38 | Ga0466735_078866 | 3300042624 | Unclassified | 1084 |
| 39 | Ga0466727_196093 | 3300042655 | Bacteria | 1126 |
| 40 | Ga0123354_10559193 | 3300010882 | Bacteria | 858 |
| 41 | Ga0160445_106167 | 3300012847 | Bacteria | 1983 |
| 42 | Ga0466693_371869 | 3300042592 | Bacteria | 2560 |
| 43 | Ga0466691_174399 | 3300042593 | Bacteria | 16587 |
| 44 | Ga0466696_365629 | 3300042596 | Bacteria | 1189 |
| 45 | Ga0466714_077519 | 3300042603 | Bacteria | 1404 |
| 46 | JGI24705J35276_11664612 | 3300002504 | Bacteria | 617 |
| 47 | JGI24696J40584_12961654 | 3300002834 | Bacteria | 28686 |
| 48 | Ga0072941_1203319 | 3300005201 | Bacteria | 1489 |
| 49 | Ga0466715_158340 | 3300042616 | Bacteria | 12847 |
| 50 | Ga0466718_049353 | 3300042617 | Bacteria | 1488 |
| 51 | Ga0466726_304338 | 3300042619 | Bacteria | 1157 |
| 52 | Ga0466703_333836 | 3300042636 | Bacteria | 1590 |
| 53 | Ga0466704_022550 | 3300042643 | Bacteria | 4430 |
| 54 | Ga0123353_10084372 | 3300010167 | Bacteria | 5113 |
| 55 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 56 | Ga0466693_047917 | 3300042592 | Bacteria | 41531 |
| 57 | Ga0466694_096095 | 3300042594 | Bacteria | 1490 |
| 58 | IMNBL1DRAFT_c0002046 | 3300000062 | Bacteria | 14426 |
| 59 | IMNBL1DRAFT_c0134100 | 3300000062 | Bacteria | 643 |
| 60 | JGI24699J35502_11106522 | 3300002509 | Bacteria | 2528 |
| 61 | Ga0068305_10576942 | 3300005083 | Bacteria | 901 |
| 62 | Ga0072941_1075728 | 3300005201 | Bacteria | 5964 |
| 63 | Ga0466712_122774 | 3300042614 | Bacteria | 4985 |
| 64 | Ga0466726_380725 | 3300042619 | Bacteria | 2261 |
| 65 | Ga0466704_477034 | 3300042643 | Bacteria | 56056 |
| 66 | Ga0466708_019691 | 3300042652 | Bacteria | 10485 |
| 67 | Ga0123356_10002071 | 3300010049 | Bacteria | 21625 |
| 68 | Ga0123356_10222019 | 3300010049 | Bacteria | 1947 |
| 69 | Ga0123353_10055259 | 3300010167 | Bacteria | 6352 |
| 70 | Ga0160443_104350 | 3300012848 | Bacteria | 2152 |
| 71 | Ga0466696_450792 | 3300042596 | Bacteria | 4039 |
| 72 | Ga0466699_176642 | 3300042597 | Bacteria | 5768 |
| 73 | Ga0466706_273335 | 3300042599 | Bacteria | 46656 |
| 74 | Ga0466716_169991 | 3300042605 | Bacteria | 4616 |
| 75 | JGI24699J35502_11134085 | 3300002509 | Bacteria | 29168 |
| 76 | Ga0068305_10002010 | 3300005083 | Bacteria | 184777 |
| 77 | Ga0072940_1269116 | 3300005200 | Unclassified | 1029 |
| 78 | Ga0466735_095546 | 3300042624 | Bacteria | 1199 |
| 79 | Ga0466704_384166 | 3300042643 | Bacteria | 6102 |
| 80 | Ga0466727_289493 | 3300042655 | Archaea | 4156 |
| 81 | Ga0123353_13425103 | 3300010167 | Unclassified | 503 |
| 82 | Ga0160445_112655 | 3300012847 | Bacteria | 1204 |
| 83 | Ga0466692_190168 | 3300042591 | Bacteria | 1308 |
| 84 | Ga0466691_060045 | 3300042593 | Bacteria | 38473 |
| 85 | Ga0466701_078263 | 3300042598 | Bacteria | 1022 |
| 86 | Ga0466707_198878 | 3300042601 | Bacteria | 3920 |
| 87 | JGI24702J35022_10007851 | 3300002462 | Bacteria | 6080 |
| 88 | Ga0466711_043085 | 3300042615 | Bacteria | 9214 |
| 89 | Ga0466711_499154 | 3300042615 | Bacteria | 10071 |
| 90 | Ga0466728_029342 | 3300042620 | Bacteria | 1447 |
| 91 | Ga0466703_084108 | 3300042636 | Bacteria | 6284 |
| 92 | Ga0466724_37932 | 3300042649 | Bacteria | 325221 |
| 93 | Ga0466705_229133 | 3300042612 | Bacteria | 1072 |
| 94 | Ga0466732_245771 | 3300042656 | Unclassified | 2519 |
| 95 | Ga0123356_12241370 | 3300010049 | Bacteria | 683 |
| 96 | Ga0466694_287835 | 3300042594 | Bacteria | 1483 |
| 97 | Ga0466706_268133 | 3300042599 | Bacteria | 21759 |
| 98 | Ga0466711_002279 | 3300042615 | Bacteria | 1734 |
| 99 | Ga0466711_251252 | 3300042615 | Bacteria | 11256 |
| 100 | Ga0466726_200451 | 3300042619 | Bacteria | 6570 |
| 101 | Ga0466735_048372 | 3300042624 | Bacteria | 1336 |
| 102 | Ga0466703_223133 | 3300042636 | Bacteria | 1385 |
| 103 | Ga0466709_303313 | 3300042648 | Bacteria | 6538 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05523 | FdtA | WxcM-like, C-terminal | 8 | 135 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.