Protein Family IF05200
Metagenome
Isolate
121
Members
54
Samples
108
Scaffolds
290.89
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_269642|Ga0466696_269642_1280_2215
- Length
- 311 aa
- Sequence
- MSKPVKLTINEIMERNMKLLIFFFLISMCVLGQENNKILEQDAVVEKLADGFRFTEGPAVDPEGNIYFTDQPDDRIFKWSVEEGKLSVFHENAGRANGLYFDKQGYLLSCSDMNNEIRQIDMNGNHAVLVADFDGKRLNGPNDLWVDPAGGIYFTDPLYKRDYWTRSPEMQQDGEHVYYLSPVTKKLIRVTTDLEKPNGIIGAPDGKSLYVADIKAGKTYSYEIQPDGTLTNKKLFAAMGSDGMTIDREGNIYLTGKGVTVFNTQGEQIAHIPVEAGWTANVCFGGKDMKTLFITASENLYSLKMNVAGNK
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Blattidae
24.5%
Kalotermitidae
22.6%
Termopsidae
5.7%
Unclassified
3.8%
Drosophilidae
1.9%
Passalidae
1.9%
Rhinotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 6 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 10 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 11 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 12 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 22 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 23 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 26 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 27 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 28 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 46 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 47 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_156114 | 3300042612 | Bacteria | 14228 |
| 2 | Ga0466733_198400 | 3300042659 | Bacteria | 123976 |
| 3 | Ga0466720_218974 | 3300042607 | Bacteria | 2062 |
| 4 | Ga0466698_507815 | 3300042610 | Bacteria | 2848 |
| 5 | Ga0466709_232520 | 3300042648 | Bacteria | 1381 |
| 6 | Ga0123353_10338374 | 3300010167 | Bacteria | 2274 |
| 7 | Ga0123354_10006093 | 3300010882 | Bacteria | 17804 |
| 8 | Ga0123354_10045198 | 3300010882 | Bacteria | 6742 |
| 9 | IMNBL1DRAFT_c0008094 | 3300000062 | Bacteria | 5410 |
| 10 | JGI24702J35022_10001981 | 3300002462 | Bacteria | 12632 |
| 11 | Ga0068305_10014814 | 3300005083 | Bacteria | 7051 |
| 12 | Ga0466690_023676 | 3300042590 | Bacteria | 5965 |
| 13 | Ga0466728_465265 | 3300042620 | Bacteria | 10150 |
| 14 | Ga0466705_077431 | 3300042612 | Bacteria | 39083 |
| 15 | Ga0466705_105833 | 3300042612 | Unclassified | 15303 |
| 16 | Ga0466701_074586 | 3300042598 | Bacteria | 17388 |
| 17 | Ga0466704_065871 | 3300042643 | Bacteria | 5565 |
| 18 | Ga0466709_179897 | 3300042648 | Bacteria | 4659 |
| 19 | Ga0466727_227555 | 3300042655 | Bacteria | 10119 |
| 20 | Ga0123353_10946430 | 3300010167 | Unclassified | 1166 |
| 21 | Ga0123354_10000740 | 3300010882 | Bacteria | 35242 |
| 22 | Ga0123354_10014170 | 3300010882 | Bacteria | 12405 |
| 23 | IMNBL1DRAFT_c0002376 | 3300000062 | Bacteria | 13165 |
| 24 | JGI24702J35022_10010068 | 3300002462 | Bacteria | 5296 |
| 25 | JGI24702J35022_10012719 | 3300002462 | Bacteria | 4671 |
| 26 | JGI24705J35276_12234033 | 3300002504 | Bacteria | 5206 |
| 27 | Ga0068302_10086754 | 3300005071 | Unclassified | 5793 |
| 28 | Ga0123357_10000222 | 3300009784 | Bacteria | 53766 |
| 29 | Ga0466696_276840 | 3300042596 | Bacteria | 11317 |
| 30 | Ga0466713_124834 | 3300042602 | Bacteria | 50546 |
| 31 | Ga0466716_093504 | 3300042605 | Bacteria | 6208 |
| 32 | Ga0466698_278986 | 3300042610 | Bacteria | 2004 |
| 33 | Ga0068302_10064268 | 3300005071 | Bacteria | 3372 |
| 34 | Ga0466711_053834 | 3300042615 | Bacteria | 10425 |
| 35 | Ga0466726_284088 | 3300042619 | Bacteria | 8137 |
| 36 | Ga0466733_000983 | 3300042659 | Bacteria | 4787 |
| 37 | Ga0466700_012083 | 3300042600 | Bacteria | 1234 |
| 38 | Ga0466713_002336 | 3300042602 | Bacteria | 15603 |
| 39 | Ga0466713_135582 | 3300042602 | Bacteria | 25846 |
| 40 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 41 | Ga0466734_019092 | 3300042623 | Bacteria | 2275 |
| 42 | Ga0466703_179299 | 3300042636 | Bacteria | 6481 |
| 43 | Ga0466704_473112 | 3300042643 | Bacteria | 2864 |
| 44 | Ga0123356_10403893 | 3300010049 | Bacteria | 1504 |
| 45 | Ga0123354_10136174 | 3300010882 | Bacteria | 3069 |
| 46 | IMNBL1DRAFT_c0006457 | 3300000062 | Bacteria | 6398 |
| 47 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 48 | Ga0105008_1001327 | 3300007507 | Bacteria | 10148 |
| 49 | Ga0466728_131950 | 3300042620 | Bacteria | 16045 |
| 50 | Ga0466697_233747 | 3300042611 | Bacteria | 1680 |
| 51 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 52 | Ga0466713_145232 | 3300042602 | Bacteria | 13657 |
| 53 | Ga0466729_303287 | 3300042621 | Bacteria | 3669 |
| 54 | Ga0466703_156923 | 3300042636 | Bacteria | 12903 |
| 55 | Ga0466704_172850 | 3300042643 | Bacteria | 4302 |
| 56 | Ga0466709_030205 | 3300042648 | Bacteria | 36078 |
| 57 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 58 | Ga0123357_10034215 | 3300009784 | Bacteria | 6905 |
| 59 | Ga0123357_10094374 | 3300009784 | Bacteria | 3883 |
| 60 | Ga0123357_10229993 | 3300009784 | Bacteria | 2035 |
| 61 | Ga0123353_10845582 | 3300010167 | Bacteria | 1255 |
| 62 | Ga0068305_10009904 | 3300005083 | Bacteria | 41398 |
| 63 | Ga0466690_155525 | 3300042590 | Bacteria | 2348 |
| 64 | Ga0466693_005260 | 3300042592 | Bacteria | 2214 |
| 65 | Ga0466696_227766 | 3300042596 | Bacteria | 8952 |
| 66 | Ga0466715_496574 | 3300042616 | Bacteria | 33816 |
| 67 | Ga0466733_053599 | 3300042659 | Bacteria | 11464 |
| 68 | Ga0466733_173674 | 3300042659 | Bacteria | 23559 |
| 69 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 70 | Ga0466703_391743 | 3300042636 | Bacteria | 10391 |
| 71 | Ga0466704_025792 | 3300042643 | Bacteria | 7110 |
| 72 | Ga0466704_108172 | 3300042643 | Bacteria | 11724 |
| 73 | Ga0123357_10008660 | 3300009784 | Bacteria | 12742 |
| 74 | Ga0123353_10497304 | 3300010167 | Bacteria | 1778 |
| 75 | Ga0123354_10009800 | 3300010882 | Bacteria | 14720 |
| 76 | JGI24702J35022_10137434 | 3300002462 | Bacteria | 1361 |
| 77 | JGI24702J35022_10181470 | 3300002462 | Unclassified | 1196 |
| 78 | JGI24702J35022_10207208 | 3300002462 | Bacteria | 1124 |
| 79 | Ga0072941_1322262 | 3300005201 | Bacteria | 2936 |
| 80 | Ga0466718_106684 | 3300042617 | Bacteria | 1465 |
| 81 | Ga0466733_205403 | 3300042659 | Bacteria | 50942 |
| 82 | Ga0466700_084482 | 3300042600 | Bacteria | 13770 |
| 83 | Ga0466700_402810 | 3300042600 | Bacteria | 14043 |
| 84 | Ga0466731_280303 | 3300042622 | Bacteria | 5778 |
| 85 | Ga0466704_537570 | 3300042643 | Bacteria | 25299 |
| 86 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 87 | Ga0123356_10010524 | 3300010049 | Bacteria | 9073 |
| 88 | Ga0123353_10083111 | 3300010167 | Bacteria | 5152 |
| 89 | JGI24702J35022_10000797 | 3300002462 | Bacteria | 19502 |
| 90 | Ga0466657_080118 | 3300042582 | Bacteria | 1509 |
| 91 | Ga0466694_327510 | 3300042594 | Bacteria | 2575 |
| 92 | Ga0466696_399641 | 3300042596 | Bacteria | 27432 |
| 93 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 94 | Ga0466726_072101 | 3300042619 | Bacteria | 6736 |
| 95 | Ga0466705_236763 | 3300042612 | Bacteria | 1359 |
| 96 | Ga0466729_246228 | 3300042621 | Bacteria | 3185 |
| 97 | Ga0466704_131219 | 3300042643 | Bacteria | 2916 |
| 98 | Ga0466704_194655 | 3300042643 | Bacteria | 4583 |
| 99 | Ga0466704_559902 | 3300042643 | Bacteria | 1367 |
| 100 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 101 | Ga0123354_10208163 | 3300010882 | Bacteria | 2124 |
| 102 | JGI24702J35022_10002441 | 3300002462 | Bacteria | 11336 |
| 103 | JGI24702J35022_10033728 | 3300002462 | Bacteria | 2737 |
| 104 | Ga0072940_1282733 | 3300005200 | Bacteria | 1041 |
| 105 | Ga0466656_258754 | 3300042550 | Bacteria | 1082 |
| 106 | Ga0466696_017777 | 3300042596 | Bacteria | 7192 |
| 107 | Ga0466696_269642 | 3300042596 | Bacteria | 17732 |
| 108 | Ga0466715_366697 | 3300042616 | Bacteria | 28419 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01731 | GO:0004064 | arylesterase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.