Protein Family IF05196
Metagenome
Isolate
225
Members
56
Samples
212
Scaffolds
472.82
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_254689|Ga0466696_254689_8695_10341
- Length
- 548 aa
- Sequence
- MQRYEKSPHIYANPFKTCDGICRKKVRFHIIRKEHFRMLHYKKNKNVCAHIAYLKKGFIFANHNYEIIYIQILINKIMTTRRGFLKAATMASAGLAMGGVRLNASSYRQIIGANEKVNLACVGIGFRGAEIIREFAKTGLANVVALCDIDMGAKHTQEIMNMFPNAARFKDFRVMFDKMGNKFDAVCAGIPDFAHYPVVMHSIKEGKHIYVEKPMCRTFLEGELMIEAAKKNPKIVTQMGNQGHSDANYFQFKAWKEAGIIKDVTAVTAHMNSSRRWHGWDSRIYKYPAPNPMPAGIDWDTWNMAVQYHEFNEKYHYGNWRCWYDLGMGALGDWGAHILDTIHEFLELGLPYEINPLMLKEHNDYFFPMSSTILFRFAERKKMPAVDITWYDGVDNVPQVPEGYGVSEVDPNIPAVAGGKLQPLKLNPGKEIYSKTLTFKGGSHGSTLSIIPQEKAKEMESKLPEVPKSTSNHYANFLLACQGKEKTRSPFEIAGPLSQVFCLGVMAQRLNTKLEFDSVKRQITNNPFANAMLAGAPPRLGWEEYYKI
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
25.5%
Termitidae
23.6%
Unclassified
10.9%
Blattidae
9.1%
Rhinotermitidae
7.3%
Termopsidae
7.3%
Passalidae
3.6%
Elmidae
3.6%
Formicidae
1.8%
Hodotermitidae
1.8%
Hydrophilidae
1.8%
Drosophilidae
1.8%
Armadillidiidae
1.8%
Taxonomy
Archaea
0
Bacteria
221
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 2 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 6 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 24 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 42 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 43 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 47 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 54 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 55 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_050656 | 3300042612 | Bacteria | 13794 |
| 2 | Ga0466733_185011 | 3300042659 | Bacteria | 4201 |
| 3 | Ga0466714_008838 | 3300042603 | Bacteria | 1803 |
| 4 | Ga0466714_038946 | 3300042603 | Bacteria | 17159 |
| 5 | Ga0466722_166637 | 3300042609 | Bacteria | 4009 |
| 6 | Ga0466715_484657 | 3300042616 | Bacteria | 16388 |
| 7 | Ga0466723_178715 | 3300042618 | Bacteria | 8887 |
| 8 | Ga0466729_036250 | 3300042621 | Bacteria | 1939 |
| 9 | Ga0466729_271010 | 3300042621 | Bacteria | 4546 |
| 10 | Ga0466729_305746 | 3300042621 | Bacteria | 2729 |
| 11 | Ga0466703_036528 | 3300042636 | Bacteria | 3261 |
| 12 | Ga0466703_145130 | 3300042636 | Bacteria | 20034 |
| 13 | Ga0466703_404644 | 3300042636 | Bacteria | 7796 |
| 14 | Ga0466703_411209 | 3300042636 | Unclassified | 12869 |
| 15 | Ga0466704_408938 | 3300042643 | Bacteria | 21684 |
| 16 | Ga0466709_299343 | 3300042648 | Bacteria | 9281 |
| 17 | Ga0466727_076463 | 3300042655 | Bacteria | 19902 |
| 18 | IMNBL1DRAFT_c0005039 | 3300000062 | Bacteria | 7696 |
| 19 | IMNBL1DRAFT_c0012288 | 3300000062 | Bacteria | 3926 |
| 20 | JGI24702J35022_10000263 | 3300002462 | Bacteria | 30153 |
| 21 | Ga0466690_177531 | 3300042590 | Bacteria | 10819 |
| 22 | Ga0466691_028383 | 3300042593 | Bacteria | 5145 |
| 23 | Ga0466691_115908 | 3300042593 | Bacteria | 26134 |
| 24 | Ga0466696_106457 | 3300042596 | Bacteria | 8644 |
| 25 | Ga0466696_188738 | 3300042596 | Bacteria | 16635 |
| 26 | Ga0466696_284554 | 3300042596 | Bacteria | 4071 |
| 27 | Ga0466696_300156 | 3300042596 | Bacteria | 15826 |
| 28 | Ga0466705_351774 | 3300042612 | Bacteria | 11083 |
| 29 | Ga0466705_375359 | 3300042612 | Bacteria | 8509 |
| 30 | Ga0466733_124081 | 3300042659 | Bacteria | 19731 |
| 31 | Ga0466701_078298 | 3300042598 | Bacteria | 25171 |
| 32 | Ga0466713_083350 | 3300042602 | Bacteria | 30734 |
| 33 | Ga0466713_120182 | 3300042602 | Bacteria | 54854 |
| 34 | Ga0466714_003209 | 3300042603 | Bacteria | 3595 |
| 35 | Ga0466716_432052 | 3300042605 | Bacteria | 7233 |
| 36 | Ga0123357_10008187 | 3300009784 | Bacteria | 13026 |
| 37 | Ga0123356_10077617 | 3300010049 | Bacteria | 3133 |
| 38 | Ga0123353_10001041 | 3300010167 | Bacteria | 33987 |
| 39 | Ga0466711_074116 | 3300042615 | Bacteria | 4195 |
| 40 | Ga0466715_420883 | 3300042616 | Bacteria | 23018 |
| 41 | Ga0466723_104638 | 3300042618 | Bacteria | 6392 |
| 42 | Ga0466726_102832 | 3300042619 | Bacteria | 8723 |
| 43 | Ga0466735_051174 | 3300042624 | Bacteria | 3571 |
| 44 | Ga0466703_168722 | 3300042636 | Bacteria | 14641 |
| 45 | Ga0466727_040231 | 3300042655 | Bacteria | 9359 |
| 46 | Ga0068302_10336427 | 3300005071 | Bacteria | 2619 |
| 47 | Ga0068305_10122809 | 3300005083 | Bacteria | 3792 |
| 48 | Ga0123357_10000088 | 3300009784 | Bacteria | 73731 |
| 49 | Ga0466696_152003 | 3300042596 | Bacteria | 3594 |
| 50 | Ga0466696_366042 | 3300042596 | Bacteria | 3093 |
| 51 | Ga0466705_127390 | 3300042612 | Bacteria | 5144 |
| 52 | Ga0466705_204903 | 3300042612 | Bacteria | 8303 |
| 53 | Ga0466733_122192 | 3300042659 | Bacteria | 22673 |
| 54 | Ga0466706_229453 | 3300042599 | Bacteria | 19642 |
| 55 | Ga0466707_419961 | 3300042601 | Bacteria | 6833 |
| 56 | Ga0466713_026078 | 3300042602 | Bacteria | 10505 |
| 57 | Ga0466713_054718 | 3300042602 | Bacteria | 26012 |
| 58 | Ga0466713_059945 | 3300042602 | Bacteria | 6143 |
| 59 | Ga0466719_030599 | 3300042606 | Bacteria | 14291 |
| 60 | Ga0466719_433332 | 3300042606 | Bacteria | 5656 |
| 61 | Ga0123353_10447213 | 3300010167 | Bacteria | 1904 |
| 62 | Ga0466711_022651 | 3300042615 | Bacteria | 9456 |
| 63 | Ga0466715_345663 | 3300042616 | Bacteria | 19788 |
| 64 | Ga0466715_362750 | 3300042616 | Bacteria | 12685 |
| 65 | Ga0466715_559932 | 3300042616 | Bacteria | 5800 |
| 66 | Ga0466723_053883 | 3300042618 | Bacteria | 24209 |
| 67 | Ga0466723_367321 | 3300042618 | Bacteria | 5462 |
| 68 | Ga0466704_093118 | 3300042643 | Bacteria | 21105 |
| 69 | Ga0466704_380557 | 3300042643 | Unclassified | 3638 |
| 70 | Ga0466709_122416 | 3300042648 | Bacteria | 5435 |
| 71 | Ga0466709_168950 | 3300042648 | Bacteria | 102495 |
| 72 | Ga0466708_213620 | 3300042652 | Bacteria | 16319 |
| 73 | Ga0466727_097939 | 3300042655 | Bacteria | 8171 |
| 74 | Ga0466727_146335 | 3300042655 | Bacteria | 2008 |
| 75 | Ga0466727_182921 | 3300042655 | Bacteria | 7420 |
| 76 | IMNBL1DRAFT_c0000258 | 3300000062 | Bacteria | 46723 |
| 77 | IMNBL1DRAFT_c0001635 | 3300000062 | Bacteria | 16581 |
| 78 | JGI24702J35022_10017165 | 3300002462 | Bacteria | 3959 |
| 79 | JGI24702J35022_10023426 | 3300002462 | Bacteria | 3339 |
| 80 | Ga0466733_145199 | 3300042659 | Bacteria | 6282 |
| 81 | Ga0466713_009309 | 3300042602 | Bacteria | 64734 |
| 82 | Ga0466713_063557 | 3300042602 | Bacteria | 2831 |
| 83 | Ga0466713_102907 | 3300042602 | Bacteria | 38987 |
| 84 | Ga0466716_309736 | 3300042605 | Bacteria | 9008 |
| 85 | Ga0466719_267829 | 3300042606 | Bacteria | 2815 |
| 86 | Ga0466722_160383 | 3300042609 | Bacteria | 27402 |
| 87 | Ga0123353_10036803 | 3300010167 | Bacteria | 7669 |
| 88 | Ga0466705_492074 | 3300042612 | Bacteria | 28382 |
| 89 | Ga0466710_069539 | 3300042613 | Bacteria | 5324 |
| 90 | Ga0466710_163966 | 3300042613 | Unclassified | 2866 |
| 91 | Ga0466723_049242 | 3300042618 | Bacteria | 72461 |
| 92 | Ga0466735_052811 | 3300042624 | Bacteria | 3207 |
| 93 | Ga0466703_315854 | 3300042636 | Bacteria | 14507 |
| 94 | Ga0466704_054576 | 3300042643 | Bacteria | 6809 |
| 95 | Ga0466709_413859 | 3300042648 | Bacteria | 11271 |
| 96 | Ga0466727_059638 | 3300042655 | Bacteria | 76336 |
| 97 | Ga0466727_172499 | 3300042655 | Bacteria | 33707 |
| 98 | IMNBL1DRAFT_c0000424 | 3300000062 | Bacteria | 35477 |
| 99 | Ga0466690_029646 | 3300042590 | Bacteria | 5818 |
| 100 | Ga0466690_029701 | 3300042590 | Bacteria | 8580 |
| 101 | Ga0466690_329972 | 3300042590 | Bacteria | 9478 |
| 102 | Ga0466695_199960 | 3300042595 | Bacteria | 1746 |
| 103 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 104 | Ga0466705_355228 | 3300042612 | Bacteria | 5150 |
| 105 | Ga0466733_206062 | 3300042659 | Bacteria | 181980 |
| 106 | Ga0466706_193344 | 3300042599 | Bacteria | 17779 |
| 107 | Ga0466713_140874 | 3300042602 | Bacteria | 46073 |
| 108 | Ga0466714_039793 | 3300042603 | Bacteria | 4034 |
| 109 | Ga0466714_073256 | 3300042603 | Bacteria | 3431 |
| 110 | Ga0466722_126933 | 3300042609 | Bacteria | 2208 |
| 111 | Ga0466722_134456 | 3300042609 | Bacteria | 6064 |
| 112 | Ga0123353_10165337 | 3300010167 | Bacteria | 3517 |
| 113 | Ga0123354_10002412 | 3300010882 | Bacteria | 24639 |
| 114 | Ga0123354_10092285 | 3300010882 | Bacteria | 4173 |
| 115 | Ga0466711_152133 | 3300042615 | Bacteria | 11698 |
| 116 | Ga0466715_003940 | 3300042616 | Bacteria | 3450 |
| 117 | Ga0466715_352974 | 3300042616 | Bacteria | 25463 |
| 118 | Ga0466726_071300 | 3300042619 | Bacteria | 6139 |
| 119 | Ga0466726_364228 | 3300042619 | Bacteria | 7092 |
| 120 | Ga0466728_030537 | 3300042620 | Bacteria | 15799 |
| 121 | Ga0466728_153393 | 3300042620 | Bacteria | 1523 |
| 122 | Ga0466703_329220 | 3300042636 | Bacteria | 14638 |
| 123 | Ga0466704_103572 | 3300042643 | Unclassified | 1873 |
| 124 | Ga0466704_475220 | 3300042643 | Bacteria | 16079 |
| 125 | Ga0466708_054511 | 3300042652 | Bacteria | 38692 |
| 126 | Ga0466727_007006 | 3300042655 | Bacteria | 16828 |
| 127 | Ga0466727_190487 | 3300042655 | Bacteria | 4048 |
| 128 | Ga0466727_314677 | 3300042655 | Bacteria | 8124 |
| 129 | 2227497982 | 2225789004 | Bacteria | 3877 |
| 130 | IMNBL1DRAFT_c0002999 | 3300000062 | Bacteria | 11189 |
| 131 | CVPL010W_10000014 | 3300002931 | Bacteria | 89080 |
| 132 | Ga0072940_1223394 | 3300005200 | Bacteria | 1831 |
| 133 | Ga0160443_100014 | 3300012848 | Bacteria | 456539 |
| 134 | Ga0466692_049137 | 3300042591 | Bacteria | 5047 |
| 135 | Ga0466691_066626 | 3300042593 | Bacteria | 11444 |
| 136 | Ga0466696_254689 | 3300042596 | Bacteria | 35518 |
| 137 | Ga0466696_378075 | 3300042596 | Bacteria | 16811 |
| 138 | Ga0466733_025328 | 3300042659 | Bacteria | 16469 |
| 139 | Ga0466733_222786 | 3300042659 | Bacteria | 9582 |
| 140 | Ga0466707_323561 | 3300042601 | Bacteria | 9949 |
| 141 | Ga0466713_107127 | 3300042602 | Bacteria | 6738 |
| 142 | Ga0466714_169325 | 3300042603 | Bacteria | 11654 |
| 143 | Ga0466716_386517 | 3300042605 | Bacteria | 12527 |
| 144 | Ga0466719_348804 | 3300042606 | Bacteria | 1856 |
| 145 | Ga0466722_092034 | 3300042609 | Bacteria | 2303 |
| 146 | Ga0466715_088285 | 3300042616 | Bacteria | 1539 |
| 147 | Ga0466715_240953 | 3300042616 | Bacteria | 36603 |
| 148 | Ga0466715_327354 | 3300042616 | Bacteria | 7529 |
| 149 | Ga0466735_046394 | 3300042624 | Bacteria | 2249 |
| 150 | Ga0466735_115495 | 3300042624 | Bacteria | 3352 |
| 151 | Ga0466704_516449 | 3300042643 | Bacteria | 7709 |
| 152 | JGI24702J35022_10009407 | 3300002462 | Bacteria | 5485 |
| 153 | JGI24702J35022_10011880 | 3300002462 | Bacteria | 4850 |
| 154 | Ga0068305_10025532 | 3300005083 | Bacteria | 3292 |
| 155 | Ga0068305_10113559 | 3300005083 | Bacteria | 8533 |
| 156 | Ga0104048_1000127 | 3300007143 | Bacteria | 7759 |
| 157 | Ga0466692_098494 | 3300042591 | Bacteria | 22280 |
| 158 | Ga0466691_020030 | 3300042593 | Bacteria | 4989 |
| 159 | Ga0466691_130019 | 3300042593 | Bacteria | 3302 |
| 160 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 161 | Ga0466733_066536 | 3300042659 | Bacteria | 9056 |
| 162 | Ga0466707_251634 | 3300042601 | Bacteria | 23431 |
| 163 | Ga0466713_011926 | 3300042602 | Bacteria | 4306 |
| 164 | Ga0466713_060432 | 3300042602 | Bacteria | 24711 |
| 165 | Ga0466716_055680 | 3300042605 | Bacteria | 4995 |
| 166 | Ga0466716_260148 | 3300042605 | Bacteria | 10950 |
| 167 | Ga0466719_101880 | 3300042606 | Bacteria | 3735 |
| 168 | Ga0466719_267937 | 3300042606 | Bacteria | 7884 |
| 169 | Ga0466719_294063 | 3300042606 | Bacteria | 5457 |
| 170 | Ga0466719_454862 | 3300042606 | Bacteria | 6928 |
| 171 | Ga0466722_176725 | 3300042609 | Bacteria | 21822 |
| 172 | Ga0466722_200913 | 3300042609 | Bacteria | 5551 |
| 173 | Ga0466722_246715 | 3300042609 | Bacteria | 5671 |
| 174 | Ga0123353_10009026 | 3300010167 | Bacteria | 13700 |
| 175 | Ga0466711_071376 | 3300042615 | Bacteria | 34883 |
| 176 | Ga0466715_493523 | 3300042616 | Bacteria | 4039 |
| 177 | Ga0466723_175652 | 3300042618 | Bacteria | 41824 |
| 178 | Ga0466726_045942 | 3300042619 | Bacteria | 7738 |
| 179 | Ga0466728_312473 | 3300042620 | Bacteria | 9005 |
| 180 | Ga0466729_009005 | 3300042621 | Bacteria | 7403 |
| 181 | Ga0466735_115935 | 3300042624 | Bacteria | 6119 |
| 182 | Ga0466703_080680 | 3300042636 | Bacteria | 9301 |
| 183 | Ga0466708_089052 | 3300042652 | Bacteria | 19306 |
| 184 | Ga0466708_110574 | 3300042652 | Bacteria | 3451 |
| 185 | Ga0466708_130146 | 3300042652 | Bacteria | 12960 |
| 186 | Ga0160441_100007 | 3300012825 | Bacteria | 523988 |
| 187 | Ga0466690_254247 | 3300042590 | Bacteria | 29646 |
| 188 | Ga0466692_136638 | 3300042591 | Bacteria | 2605 |
| 189 | Ga0466692_138966 | 3300042591 | Bacteria | 7013 |
| 190 | Ga0466696_151297 | 3300042596 | Bacteria | 6433 |
| 191 | Ga0466697_206657 | 3300042611 | Bacteria | 1832 |
| 192 | Ga0466733_024002 | 3300042659 | Bacteria | 39250 |
| 193 | Ga0466733_080869 | 3300042659 | Bacteria | 63970 |
| 194 | Ga0466706_035083 | 3300042599 | Bacteria | 13471 |
| 195 | Ga0466706_080135 | 3300042599 | Bacteria | 35638 |
| 196 | Ga0466707_041440 | 3300042601 | Bacteria | 17365 |
| 197 | Ga0466707_092083 | 3300042601 | Bacteria | 6125 |
| 198 | Ga0466714_016374 | 3300042603 | Bacteria | 8289 |
| 199 | Ga0466714_023416 | 3300042603 | Bacteria | 15021 |
| 200 | Ga0466714_062083 | 3300042603 | Bacteria | 13276 |
| 201 | Ga0466719_469563 | 3300042606 | Bacteria | 2927 |
| 202 | Ga0466711_147959 | 3300042615 | Bacteria | 2572 |
| 203 | Ga0466711_445766 | 3300042615 | Bacteria | 24801 |
| 204 | Ga0466715_101180 | 3300042616 | Bacteria | 5545 |
| 205 | Ga0466723_155736 | 3300042618 | Bacteria | 5604 |
| 206 | Ga0466728_274849 | 3300042620 | Bacteria | 19248 |
| 207 | Ga0466735_104862 | 3300042624 | Bacteria | 5240 |
| 208 | Ga0466703_307692 | 3300042636 | Bacteria | 3703 |
| 209 | Ga0466704_364275 | 3300042643 | Bacteria | 12217 |
| 210 | Ga0466725_203212 | 3300042654 | Bacteria | 21837 |
| 211 | Ga0466727_345510 | 3300042655 | Bacteria | 3939 |
| 212 | Ga0068305_10055120 | 3300005083 | Bacteria | 34511 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.