Protein Family IF05185

Metagenome Isolate
140 Members
53 Samples
125 Scaffolds
575.4 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_211426|Ga0466696_211426_102_1640
Length
512 aa
Sequence
LGLDAVKIPKPAGLSASQLARFRVIAGEEFVRTDGYARLSASYGKSVYDLLRMRNKIAENIPDAVIYPDSREQIEAIVSRCASEKIPLYVCGGGTSLTRGTECVRGGVSLDMRLRFNKAVGFNEVDQSVTVEAGMSGSKLETLLNNAEKEFGGKRPYTCGHFPRSFGHSTVGGWVMTGGSGRDSGYYGGIRDIVLGGDYATPSGAIFTSRYSNKAAGPDLCRIMAGSEGAFGVLTHVTLKVFRRHPDARRFACVFKDWETAQAAAREIMQAGEGFPPALRLSDPEETGVLMRVFEVTENPLGRLLEARGFRFDKMCLLEGWVGGSRGLLRGAPENERKVAARFGAFRFSGIAARLWEKYQDSVPYFRDAVQDFGFVLDTLECGVSWSNMGRVYRELRAYAGGFPRTLCMTRVEHMDPQGADLCLTFITRMRDPEEYRKFHAGFMDLVARCDACISGHYGIGKLSGPWLEGYLGRNEYAVIRALKRHFDPGNIMNPGGTLGLDLDGKDRHFWG

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Unclassified 30.8%
Kalotermitidae 26.9%
Termopsidae 3.8%
Rhinotermitidae 3.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
3 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
4 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
5 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
6 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
7 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
8 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
9 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
36 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
37 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
48 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
49 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
50 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
51 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
52 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
53 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_434368 3300042612 Bacteria 2976
2 Ga0466712_092832 3300042614 Bacteria 12178
3 Ga0466726_167406 3300042619 Bacteria 2275
4 Ga0123353_10395825 3300010167 Bacteria 2058
5 Ga0466703_393525 3300042636 Bacteria 72819
6 Ga0466709_035984 3300042648 Bacteria 3158
7 Ga0466709_342141 3300042648 Bacteria 17575
8 Ga0466708_227307 3300042652 Bacteria 7590
9 Ga0466708_435726 3300042652 Bacteria 7188
10 Ga0466690_179728 3300042590 Bacteria 9245
11 Ga0466691_076227 3300042593 Bacteria 10240
12 Ga0466691_125413 3300042593 Bacteria 15124
13 Ga0466691_128223 3300042593 Bacteria 6835
14 JGI24695J34938_10000502 3300002450 Bacteria 38047
15 JGI24695J34938_10006244 3300002450 Bacteria 7226
16 Ga0466714_058231 3300042603 Bacteria 3083
17 Ga0466716_375585 3300042605 Bacteria 3608
18 Ga0466732_021230 3300042656 Unclassified 2622
19 Ga0466711_291994 3300042615 Bacteria 7328
20 Ga0466723_061750 3300042618 Bacteria 30747
21 Ga0466723_087343 3300042618 Bacteria 15969
22 Ga0123356_10002053 3300010049 Bacteria 21712
23 Ga0466704_602352 3300042643 Bacteria 8859
24 Ga0466709_249110 3300042648 Bacteria 4511
25 Ga0466709_336496 3300042648 Bacteria 5832
26 Ga0466708_315749 3300042652 Bacteria 28028
27 JGI24698J34947_10005365 3300002449 Bacteria 7030
28 JGI24702J35022_10051803 3300002462 Bacteria 2188
29 JGI24697J35500_11274741 3300002507 Bacteria 9211
30 JGI24696J40584_12950062 3300002834 Unclassified 2120
31 Ga0466713_098884 3300042602 Bacteria 29957
32 Ga0466716_156019 3300042605 Bacteria 2329
33 Ga0466722_112456 3300042609 Bacteria 2235
34 Ga0466705_092199 3300042612 Bacteria 7440
35 Ga0466732_066149 3300042656 Bacteria 2060
36 Ga0466712_032984 3300042614 Bacteria 15935
37 Ga0466715_007302 3300042616 Bacteria 8280
38 Ga0466715_352760 3300042616 Bacteria 2415
39 Ga0466723_208531 3300042618 Bacteria 2864
40 Ga0466726_125297 3300042619 Bacteria 2690
41 Ga0466726_455692 3300042619 Bacteria 3957
42 Ga0123353_10000783 3300010167 Bacteria 38755
43 Ga0466735_080044 3300042624 Bacteria 4548
44 Ga0466704_021151 3300042643 Bacteria 26276
45 Ga0466708_033268 3300042652 Bacteria 2163
46 Ga0466691_000159 3300042593 Bacteria 2399
47 Ga0466699_277466 3300042597 Bacteria 6150
48 JGI24698J34947_10030200 3300002449 Bacteria 2859
49 JGI24695J34938_10000035 3300002450 Bacteria 102136
50 Ga0466707_235930 3300042601 Bacteria 15290
51 Ga0466716_051481 3300042605 Bacteria 8757
52 Ga0466719_015205 3300042606 Bacteria 10472
53 Ga0466732_151112 3300042656 Bacteria 2202
54 Ga0466712_037549 3300042614 Bacteria 7780
55 Ga0466712_059677 3300042614 Bacteria 14575
56 Ga0466718_022424 3300042617 Archaea 3120
57 Ga0466718_075321 3300042617 Unclassified 4723
58 Ga0123356_10010961 3300010049 Bacteria 8855
59 Ga0123356_10076388 3300010049 Bacteria 3157
60 Ga0123353_10000539 3300010167 Bacteria 46894
61 Ga0123353_10009526 3300010167 Bacteria 13424
62 Ga0123353_10041204 3300010167 Unclassified 7293
63 Ga0123354_10153331 3300010882 Bacteria 2778
64 Ga0466704_132596 3300042643 Unclassified 11677
65 Ga0466708_127613 3300042652 Bacteria 5420
66 Ga0466692_161246 3300042591 Bacteria 3682
67 Ga0466691_097940 3300042593 Bacteria 12799
68 JGI24702J35022_10010215 3300002462 Bacteria 5255
69 Ga0466706_181980 3300042599 Bacteria 27558
70 Ga0466707_133939 3300042601 Bacteria 10352
71 Ga0466707_380559 3300042601 Bacteria 4178
72 Ga0466713_118055 3300042602 Bacteria 3153
73 Ga0466705_484851 3300042612 Bacteria 21219
74 Ga0466712_113200 3300042614 Bacteria 4714
75 Ga0466711_062257 3300042615 Bacteria 8239
76 Ga0466728_383806 3300042620 Bacteria 10064
77 Ga0123355_10149767 3300009826 Bacteria 3548
78 Ga0123353_10135720 3300010167 Bacteria 3946
79 Ga0466692_017814 3300042591 Bacteria 21119
80 Ga0466696_015647 3300042596 Bacteria 26152
81 AustNasuHG_c1000099 3300000089 Bacteria 25536
82 Ga0466721_294222 3300042608 Bacteria 5348
83 Ga0466712_118323 3300042614 Bacteria 21090
84 Ga0466712_318937 3300042614 Bacteria 10919
85 Ga0466711_029426 3300042615 Bacteria 19240
86 Ga0466726_025758 3300042619 Bacteria 10784
87 Ga0466726_136081 3300042619 Bacteria 2629
88 Ga0466728_123207 3300042620 Bacteria 6364
89 Ga0466703_004288 3300042636 Bacteria 14501
90 Ga0466703_177637 3300042636 Bacteria 197398
91 Ga0466693_332400 3300042592 Bacteria 40906
92 Ga0466699_262955 3300042597 Bacteria 3755
93 JGI24698J34947_10000067 3300002449 Bacteria 32875
94 JGI24698J34947_10026759 3300002449 Bacteria 3063
95 Ga0466713_149148 3300042602 Bacteria 35550
96 Ga0466719_036370 3300042606 Bacteria 2932
97 Ga0466722_192504 3300042609 Bacteria 17517
98 Ga0466712_138833 3300042614 Bacteria 16191
99 Ga0466723_023190 3300042618 Bacteria 28471
100 Ga0466726_228058 3300042619 Unclassified 2665
101 Ga0123356_10009052 3300010049 Bacteria 9846
102 Ga0466703_017139 3300042636 Bacteria 8824
103 Ga0466690_050785 3300042590 Bacteria 8238
104 Ga0466691_023024 3300042593 Unclassified 6996
105 Ga0466696_211426 3300042596 Bacteria 3739
106 JGI24698J34947_10000420 3300002449 Bacteria 19435
107 JGI24698J34947_10030217 3300002449 Unclassified 2858
108 JGI24695J34938_10000880 3300002450 Bacteria 27708
109 JGI24702J35022_10024595 3300002462 Bacteria 3253
110 Ga0072941_1005124 3300005201 Bacteria 25954
111 Ga0072941_1007357 3300005201 Bacteria 37252
112 Ga0466714_028521 3300042603 Bacteria 38215
113 Ga0466711_124285 3300042615 Bacteria 5194
114 Ga0466726_193839 3300042619 Bacteria 9921
115 Ga0123354_10085998 3300010882 Bacteria 4399
116 Ga0466704_168640 3300042643 Bacteria 16046
117 Ga0466704_188001 3300042643 Bacteria 7493
118 JGI24695J34938_10006003 3300002450 Bacteria 7417
119 JGI24695J34938_10008279 3300002450 Bacteria 5944
120 Ga0072941_1064262 3300005201 Bacteria 6608
121 Ga0466706_006038 3300042599 Bacteria 1824
122 Ga0466706_075476 3300042599 Bacteria 3642
123 Ga0466719_216736 3300042606 Bacteria 7508
124 Ga0466719_326190 3300042606 Bacteria 23120
125 Ga0466722_108364 3300042609 Bacteria 6323

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01565 FAD_binding_4 FAD binding domain 62 208 0.92
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 249 496 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.