Protein Family IF05142
Metagenome
Isolate
198
Members
47
Samples
192
Scaffolds
274.16
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_112916|Ga0466696_112916_1827_2759
- Length
- 310 aa
- Sequence
- MDTADHHRRPDGGDLPGFRFAGQLRERRMKRRTGRALYAAFANIVIIVLGIGMLYPVAWLIAASFKESNTIFSDPGLIPRAFTLQNYAKGWAGIGIVGFDTFFINSFILCILCVIANAVFCSLTAYAFGRLRFKFRNFWFAVMMLTLMLPSHVTTIPRYVIFRSFGWINTYLPLIVPKLFATDAFFVFLLVQFIRSLPKDLDESALIDGCGKFGIYVRIIMPLTVPALITTVLFTFLWTWDDFFNQLLYLNSPSTYTVPMGLRLFLDSSGMSSWGSMFAMSVLSIVPCFILFFSLQKYFVQGITTTGIKG
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
32.6%
Unclassified
13.0%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Hodotermitidae
2.2%
Scarabaeidae
2.2%
Armadillidiidae
2.2%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 12 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 28 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 37 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 38 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_007021 | 3300042612 | Bacteria | 2340 |
| 2 | Ga0466712_108014 | 3300042614 | Bacteria | 37764 |
| 3 | Ga0466726_027745 | 3300042619 | Bacteria | 5074 |
| 4 | Ga0466726_198558 | 3300042619 | Bacteria | 3507 |
| 5 | Ga0466728_211606 | 3300042620 | Bacteria | 42029 |
| 6 | Ga0456237_0012397 | 3300041968 | Bacteria | 1233 |
| 7 | Ga0466690_008632 | 3300042590 | Bacteria | 7430 |
| 8 | Ga0466690_024385 | 3300042590 | Bacteria | 4163 |
| 9 | Ga0466690_027267 | 3300042590 | Bacteria | 2877 |
| 10 | Ga0466692_055497 | 3300042591 | Bacteria | 13733 |
| 11 | Ga0466694_292638 | 3300042594 | Bacteria | 2006 |
| 12 | Ga0466696_112916 | 3300042596 | Bacteria | 9072 |
| 13 | Ga0466707_091930 | 3300042601 | Bacteria | 3879 |
| 14 | Ga0466722_006745 | 3300042609 | Bacteria | 29004 |
| 15 | Ga0466722_242183 | 3300042609 | Bacteria | 9218 |
| 16 | Ga0466704_220480 | 3300042643 | Unclassified | 3523 |
| 17 | Ga0466704_265509 | 3300042643 | Unclassified | 3038 |
| 18 | Ga0466709_147374 | 3300042648 | Bacteria | 2120 |
| 19 | Ga0466705_180330 | 3300042612 | Bacteria | 9365 |
| 20 | Ga0466705_250466 | 3300042612 | Bacteria | 3099 |
| 21 | Ga0466712_013046 | 3300042614 | Bacteria | 30557 |
| 22 | Ga0466711_316005 | 3300042615 | Bacteria | 10433 |
| 23 | Ga0466715_208061 | 3300042616 | Bacteria | 8213 |
| 24 | Ga0466715_308847 | 3300042616 | Bacteria | 10607 |
| 25 | Ga0466723_033179 | 3300042618 | Unclassified | 8764 |
| 26 | Ga0466726_464950 | 3300042619 | Bacteria | 2981 |
| 27 | Ga0466728_077620 | 3300042620 | Bacteria | 4397 |
| 28 | Ga0466691_030438 | 3300042593 | Bacteria | 13523 |
| 29 | Ga0466696_024288 | 3300042596 | Bacteria | 3958 |
| 30 | Ga0466716_256248 | 3300042605 | Bacteria | 16702 |
| 31 | Ga0466719_028855 | 3300042606 | Bacteria | 31838 |
| 32 | Ga0466719_043539 | 3300042606 | Bacteria | 15883 |
| 33 | Ga0466719_181619 | 3300042606 | Bacteria | 4075 |
| 34 | Ga0466722_116439 | 3300042609 | Bacteria | 5841 |
| 35 | JGI24698J34947_10035480 | 3300002449 | Bacteria | 2602 |
| 36 | Ga0466703_311093 | 3300042636 | Bacteria | 2275 |
| 37 | Ga0466704_013984 | 3300042643 | Bacteria | 11572 |
| 38 | Ga0466704_454240 | 3300042643 | Bacteria | 5695 |
| 39 | Ga0466704_542642 | 3300042643 | Bacteria | 5131 |
| 40 | Ga0466724_13138 | 3300042649 | Bacteria | 22136 |
| 41 | Ga0466708_036098 | 3300042652 | Bacteria | 10434 |
| 42 | Ga0466708_075398 | 3300042652 | Bacteria | 5125 |
| 43 | Ga0466708_097525 | 3300042652 | Bacteria | 21369 |
| 44 | Ga0466727_245230 | 3300042655 | Bacteria | 2584 |
| 45 | Ga0466705_061620 | 3300042612 | Unclassified | 3887 |
| 46 | Ga0466705_197177 | 3300042612 | Bacteria | 9130 |
| 47 | Ga0466705_213765 | 3300042612 | Bacteria | 10851 |
| 48 | Ga0466732_217468 | 3300042656 | Bacteria | 1603 |
| 49 | Ga0466711_059958 | 3300042615 | Bacteria | 18218 |
| 50 | Ga0466711_097858 | 3300042615 | Bacteria | 3064 |
| 51 | Ga0466715_476243 | 3300042616 | Bacteria | 20035 |
| 52 | Ga0466723_023552 | 3300042618 | Unclassified | 1074 |
| 53 | Ga0466723_248620 | 3300042618 | Bacteria | 16280 |
| 54 | Ga0466726_206121 | 3300042619 | Bacteria | 2925 |
| 55 | Ga0466728_118680 | 3300042620 | Bacteria | 1842 |
| 56 | Ga0466692_103672 | 3300042591 | Bacteria | 11635 |
| 57 | Ga0466692_170989 | 3300042591 | Bacteria | 3996 |
| 58 | Ga0466693_318626 | 3300042592 | Bacteria | 1223 |
| 59 | Ga0466696_246807 | 3300042596 | Bacteria | 12162 |
| 60 | Ga0466696_320470 | 3300042596 | Bacteria | 2365 |
| 61 | Ga0466701_015207 | 3300042598 | Bacteria | 1384 |
| 62 | Ga0466707_303011 | 3300042601 | Bacteria | 3740 |
| 63 | Ga0466707_419554 | 3300042601 | Bacteria | 7120 |
| 64 | Ga0466719_129214 | 3300042606 | Bacteria | 15011 |
| 65 | Ga0466722_025025 | 3300042609 | Bacteria | 4443 |
| 66 | Ga0466735_057611 | 3300042624 | Bacteria | 8492 |
| 67 | Ga0466703_386823 | 3300042636 | Bacteria | 10527 |
| 68 | Ga0466704_270892 | 3300042643 | Bacteria | 3132 |
| 69 | Ga0466704_517574 | 3300042643 | Bacteria | 15002 |
| 70 | Ga0466708_396293 | 3300042652 | Bacteria | 7752 |
| 71 | Ga0466727_162731 | 3300042655 | Bacteria | 2445 |
| 72 | Ga0466712_122031 | 3300042614 | Unclassified | 2089 |
| 73 | Ga0466712_223291 | 3300042614 | Bacteria | 4347 |
| 74 | Ga0466711_128839 | 3300042615 | Bacteria | 2772 |
| 75 | Ga0466711_129624 | 3300042615 | Bacteria | 4859 |
| 76 | Ga0466723_053639 | 3300042618 | Bacteria | 12699 |
| 77 | Ga0466723_217435 | 3300042618 | Bacteria | 4443 |
| 78 | Ga0466726_018743 | 3300042619 | Bacteria | 2581 |
| 79 | Ga0466726_170971 | 3300042619 | Bacteria | 2837 |
| 80 | Ga0466726_422565 | 3300042619 | Bacteria | 15199 |
| 81 | Ga0466690_073038 | 3300042590 | Unclassified | 11789 |
| 82 | Ga0466690_090833 | 3300042590 | Bacteria | 11508 |
| 83 | Ga0466692_005934 | 3300042591 | Bacteria | 1534 |
| 84 | Ga0466692_091137 | 3300042591 | Bacteria | 1611 |
| 85 | Ga0466696_234145 | 3300042596 | Bacteria | 1369 |
| 86 | Ga0466707_404699 | 3300042601 | Bacteria | 2647 |
| 87 | Ga0466719_399751 | 3300042606 | Bacteria | 10138 |
| 88 | Ga0466722_255664 | 3300042609 | Bacteria | 1763 |
| 89 | Ga0466729_205613 | 3300042621 | Bacteria | 6849 |
| 90 | Ga0466703_107613 | 3300042636 | Bacteria | 21533 |
| 91 | Ga0466703_183379 | 3300042636 | Bacteria | 4954 |
| 92 | Ga0466704_177798 | 3300042643 | Unclassified | 2451 |
| 93 | Ga0466704_451963 | 3300042643 | Unclassified | 4625 |
| 94 | Ga0466709_199792 | 3300042648 | Unclassified | 11589 |
| 95 | Ga0466709_204260 | 3300042648 | Bacteria | 4249 |
| 96 | Ga0466709_324921 | 3300042648 | Bacteria | 4888 |
| 97 | Ga0466708_023289 | 3300042652 | Bacteria | 34585 |
| 98 | Ga0466708_335742 | 3300042652 | Bacteria | 2929 |
| 99 | Ga0466727_050563 | 3300042655 | Bacteria | 2926 |
| 100 | Ga0466727_107774 | 3300042655 | Unclassified | 4251 |
| 101 | Ga0466726_091966 | 3300042619 | Bacteria | 5163 |
| 102 | Ga0466726_323590 | 3300042619 | Bacteria | 3812 |
| 103 | Ga0466690_062633 | 3300042590 | Bacteria | 13417 |
| 104 | Ga0466690_276078 | 3300042590 | Bacteria | 2496 |
| 105 | Ga0466690_372900 | 3300042590 | Bacteria | 2901 |
| 106 | Ga0466692_024988 | 3300042591 | Bacteria | 5885 |
| 107 | Ga0466692_151020 | 3300042591 | Bacteria | 3830 |
| 108 | Ga0123357_10052127 | 3300009784 | Bacteria | 5526 |
| 109 | Ga0466716_099265 | 3300042605 | Bacteria | 8681 |
| 110 | Ga0466719_107663 | 3300042606 | Unclassified | 1362 |
| 111 | Ga0068305_10119673 | 3300005083 | Bacteria | 5719 |
| 112 | Ga0072941_1000276 | 3300005201 | Bacteria | 6393 |
| 113 | Ga0466735_030739 | 3300042624 | Bacteria | 31656 |
| 114 | Ga0466703_227306 | 3300042636 | Bacteria | 3335 |
| 115 | Ga0466703_253530 | 3300042636 | Unclassified | 1520 |
| 116 | Ga0466704_258027 | 3300042643 | Bacteria | 4979 |
| 117 | Ga0466709_128432 | 3300042648 | Bacteria | 11366 |
| 118 | Ga0466708_064189 | 3300042652 | Bacteria | 3832 |
| 119 | Ga0466708_074277 | 3300042652 | Bacteria | 41701 |
| 120 | Ga0466708_226103 | 3300042652 | Bacteria | 5355 |
| 121 | Ga0466725_452700 | 3300042654 | Bacteria | 2200 |
| 122 | Ga0466727_245398 | 3300042655 | Bacteria | 1872 |
| 123 | Ga0466705_034569 | 3300042612 | Bacteria | 7989 |
| 124 | Ga0466715_640072 | 3300042616 | Bacteria | 10393 |
| 125 | Ga0160444_108370 | 3300012841 | Bacteria | 1303 |
| 126 | Ga0456237_0005326 | 3300041968 | Bacteria | 2043 |
| 127 | Ga0466690_306986 | 3300042590 | Bacteria | 1394 |
| 128 | Ga0466691_175405 | 3300042593 | Bacteria | 6285 |
| 129 | Ga0466696_180816 | 3300042596 | Bacteria | 9111 |
| 130 | Ga0466696_404448 | 3300042596 | Bacteria | 25849 |
| 131 | Ga0466716_073218 | 3300042605 | Bacteria | 4567 |
| 132 | Ga0466716_385351 | 3300042605 | Bacteria | 2145 |
| 133 | Ga0466716_387401 | 3300042605 | Bacteria | 1318 |
| 134 | Ga0466716_539737 | 3300042605 | Bacteria | 3108 |
| 135 | Ga0466719_090856 | 3300042606 | Unclassified | 1497 |
| 136 | Ga0466722_250699 | 3300042609 | Bacteria | 1430 |
| 137 | Ga0466729_291695 | 3300042621 | Bacteria | 1647 |
| 138 | Ga0466703_192929 | 3300042636 | Bacteria | 1399 |
| 139 | Ga0466704_365712 | 3300042643 | Unclassified | 5012 |
| 140 | Ga0466704_479427 | 3300042643 | Unclassified | 1901 |
| 141 | Ga0466709_245149 | 3300042648 | Unclassified | 5855 |
| 142 | Ga0466727_064818 | 3300042655 | Bacteria | 17843 |
| 143 | Ga0466727_107213 | 3300042655 | Bacteria | 3415 |
| 144 | Ga0466705_332346 | 3300042612 | Bacteria | 2645 |
| 145 | Ga0466733_003658 | 3300042659 | Bacteria | 13489 |
| 146 | Ga0466705_522186 | 3300042612 | Bacteria | 12955 |
| 147 | Ga0466712_024642 | 3300042614 | Bacteria | 6190 |
| 148 | Ga0466711_312293 | 3300042615 | Bacteria | 1444 |
| 149 | Ga0466711_346574 | 3300042615 | Bacteria | 20390 |
| 150 | Ga0466715_062988 | 3300042616 | Bacteria | 16928 |
| 151 | Ga0466715_623129 | 3300042616 | Bacteria | 12456 |
| 152 | Ga0466718_010890 | 3300042617 | Bacteria | 5200 |
| 153 | Ga0466723_099447 | 3300042618 | Bacteria | 27440 |
| 154 | Ga0466723_100666 | 3300042618 | Bacteria | 10118 |
| 155 | Ga0466723_186646 | 3300042618 | Bacteria | 2058 |
| 156 | Ga0466726_042775 | 3300042619 | Bacteria | 5691 |
| 157 | Ga0466692_083429 | 3300042591 | Bacteria | 23901 |
| 158 | Ga0466692_141589 | 3300042591 | Bacteria | 9932 |
| 159 | Ga0123354_10019513 | 3300010882 | Bacteria | 10648 |
| 160 | Ga0466707_183629 | 3300042601 | Bacteria | 2689 |
| 161 | Ga0466716_510514 | 3300042605 | Bacteria | 9728 |
| 162 | Ga0466719_074159 | 3300042606 | Bacteria | 4712 |
| 163 | Ga0466719_311662 | 3300042606 | Bacteria | 2191 |
| 164 | JGI24698J34947_10087439 | 3300002449 | Unclassified | 1441 |
| 165 | Ga0072941_1018346 | 3300005201 | Unclassified | 24694 |
| 166 | Ga0466703_080048 | 3300042636 | Bacteria | 10519 |
| 167 | Ga0466703_132450 | 3300042636 | Bacteria | 6590 |
| 168 | Ga0466704_035395 | 3300042643 | Bacteria | 10724 |
| 169 | Ga0466704_545311 | 3300042643 | Unclassified | 2256 |
| 170 | Ga0466708_003955 | 3300042652 | Bacteria | 19663 |
| 171 | Ga0466727_263642 | 3300042655 | Bacteria | 1391 |
| 172 | Ga0466705_229300 | 3300042612 | Unclassified | 2615 |
| 173 | Ga0466705_420610 | 3300042612 | Bacteria | 1838 |
| 174 | Ga0466712_113896 | 3300042614 | Bacteria | 3152 |
| 175 | Ga0466712_315437 | 3300042614 | Bacteria | 1989 |
| 176 | Ga0466715_390032 | 3300042616 | Bacteria | 1921 |
| 177 | Ga0466726_141566 | 3300042619 | Bacteria | 17659 |
| 178 | Ga0466726_352008 | 3300042619 | Bacteria | 1910 |
| 179 | Ga0466726_381464 | 3300042619 | Bacteria | 1206 |
| 180 | Ga0466690_099745 | 3300042590 | Bacteria | 7254 |
| 181 | Ga0466691_004642 | 3300042593 | Unclassified | 4033 |
| 182 | Ga0466691_043613 | 3300042593 | Unclassified | 7383 |
| 183 | Ga0466691_127431 | 3300042593 | Bacteria | 14439 |
| 184 | Ga0466699_233889 | 3300042597 | Bacteria | 1382 |
| 185 | Ga0123356_10003241 | 3300010049 | Bacteria | 17096 |
| 186 | Ga0466706_141020 | 3300042599 | Unclassified | 4839 |
| 187 | Ga0466716_114398 | 3300042605 | Bacteria | 2935 |
| 188 | JGI24698J34947_10015279 | 3300002449 | Bacteria | 4180 |
| 189 | JGI24705J35276_12222122 | 3300002504 | Bacteria | 2395 |
| 190 | Ga0466703_277006 | 3300042636 | Bacteria | 1216 |
| 191 | Ga0466704_088396 | 3300042643 | Bacteria | 22654 |
| 192 | Ga0466727_062267 | 3300042655 | Bacteria | 13487 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 127 | 303 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.