Protein Family IF05119
Metagenome
Isolate
110
Members
36
Samples
108
Scaffolds
178.71
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_067990|Ga0466696_067990_2028_2687
- Length
- 202 aa
- Sequence
- MEKIYAFILFCVISGALVSKLRKMIEYIRGEIAELSPTQMVMECSGIGYELNISLTTYSAFNGRKEGKIYVYEVIREDAHLLFGFATREERELFLLLTSVSGVGPNTARMILSSLPPSELIRVIASGDDVSDLRNKVRSVEGQAEKESFAPGGRSETAEGAVAALIMLGFQKTASQKAVASVLKKTPSGTVEQVIKDALKIL
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
20.0%
Unclassified
11.4%
Rhinotermitidae
8.6%
Termopsidae
8.6%
Passalidae
5.7%
Hodotermitidae
2.9%
Blattidae
2.9%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_408081 | 3300042590 | Bacteria | 7594 |
| 2 | Ga0466692_109656 | 3300042591 | Bacteria | 13674 |
| 3 | Ga0466691_005537 | 3300042593 | Unclassified | 8388 |
| 4 | Ga0466691_091910 | 3300042593 | Bacteria | 7343 |
| 5 | Ga0466696_069019 | 3300042596 | Bacteria | 4554 |
| 6 | Ga0466705_202820 | 3300042612 | Bacteria | 8538 |
| 7 | Ga0466705_409747 | 3300042612 | Bacteria | 8638 |
| 8 | Ga0466711_037484 | 3300042615 | Bacteria | 11494 |
| 9 | Ga0466711_253863 | 3300042615 | Bacteria | 2692 |
| 10 | Ga0068302_10247025 | 3300005071 | Bacteria | 1080 |
| 11 | Ga0466713_099964 | 3300042602 | Bacteria | 24145 |
| 12 | Ga0466704_147750 | 3300042643 | Bacteria | 1154 |
| 13 | Ga0466704_365178 | 3300042643 | Bacteria | 29867 |
| 14 | Ga0466691_226692 | 3300042593 | Bacteria | 4013 |
| 15 | Ga0466711_299363 | 3300042615 | Bacteria | 8994 |
| 16 | Ga0466723_046684 | 3300042618 | Bacteria | 8856 |
| 17 | Ga0466723_250414 | 3300042618 | Bacteria | 18038 |
| 18 | Ga0466726_232707 | 3300042619 | Bacteria | 5551 |
| 19 | Ga0466707_065452 | 3300042601 | Bacteria | 19428 |
| 20 | Ga0466719_066426 | 3300042606 | Bacteria | 3132 |
| 21 | Ga0466729_197205 | 3300042621 | Bacteria | 3912 |
| 22 | Ga0466735_124435 | 3300042624 | Bacteria | 1676 |
| 23 | Ga0466735_159949 | 3300042624 | Bacteria | 1365 |
| 24 | Ga0466703_016679 | 3300042636 | Bacteria | 25517 |
| 25 | Ga0466708_058687 | 3300042652 | Bacteria | 40531 |
| 26 | Ga0466725_311063 | 3300042654 | Bacteria | 6623 |
| 27 | Ga0466690_350935 | 3300042590 | Bacteria | 1008 |
| 28 | Ga0466705_449119 | 3300042612 | Bacteria | 27557 |
| 29 | Ga0466715_317832 | 3300042616 | Bacteria | 1101 |
| 30 | Ga0466723_299222 | 3300042618 | Bacteria | 28350 |
| 31 | Ga0123353_10760779 | 3300010167 | Bacteria | 1346 |
| 32 | 2227313850 | 2225789004 | Bacteria | 1200 |
| 33 | IMNBL1DRAFT_c0008392 | 3300000062 | Unclassified | 5264 |
| 34 | JGI24702J35022_10200198 | 3300002462 | Bacteria | 1143 |
| 35 | Ga0072941_1081145 | 3300005201 | Bacteria | 9768 |
| 36 | Ga0466722_217984 | 3300042609 | Bacteria | 3502 |
| 37 | Ga0466708_264419 | 3300042652 | Bacteria | 49465 |
| 38 | Ga0466711_015732 | 3300042615 | Bacteria | 22229 |
| 39 | Ga0466711_042944 | 3300042615 | Bacteria | 8482 |
| 40 | Ga0466711_405975 | 3300042615 | Bacteria | 10553 |
| 41 | Ga0123353_11087972 | 3300010167 | Bacteria | 1063 |
| 42 | JGI24702J35022_10000101 | 3300002462 | Bacteria | 39658 |
| 43 | JGI24702J35022_10041822 | 3300002462 | Bacteria | 2442 |
| 44 | Ga0068302_10042514 | 3300005071 | Bacteria | 3928 |
| 45 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 46 | Ga0466704_147620 | 3300042643 | Bacteria | 1274 |
| 47 | Ga0466708_149614 | 3300042652 | Bacteria | 33318 |
| 48 | Ga0466690_090860 | 3300042590 | Bacteria | 14173 |
| 49 | Ga0466690_247613 | 3300042590 | Bacteria | 6308 |
| 50 | Ga0466691_032873 | 3300042593 | Bacteria | 12318 |
| 51 | Ga0466696_260879 | 3300042596 | Bacteria | 16014 |
| 52 | Ga0466696_349271 | 3300042596 | Bacteria | 17418 |
| 53 | Ga0466696_464266 | 3300042596 | Bacteria | 5388 |
| 54 | Ga0466715_521568 | 3300042616 | Bacteria | 1640 |
| 55 | Ga0466728_244432 | 3300042620 | Bacteria | 30862 |
| 56 | Ga0466728_324718 | 3300042620 | Bacteria | 11803 |
| 57 | Ga0123356_10986466 | 3300010049 | Bacteria | 1013 |
| 58 | IMNBL1DRAFT_c0000789 | 3300000062 | Bacteria | 24969 |
| 59 | Ga0466713_015150 | 3300042602 | Bacteria | 25600 |
| 60 | Ga0466716_448089 | 3300042605 | Bacteria | 8967 |
| 61 | Ga0466722_231624 | 3300042609 | Bacteria | 3198 |
| 62 | Ga0466703_120109 | 3300042636 | Bacteria | 10935 |
| 63 | Ga0466691_015647 | 3300042593 | Bacteria | 10831 |
| 64 | Ga0466696_051840 | 3300042596 | Bacteria | 26856 |
| 65 | Ga0466697_197696 | 3300042611 | Bacteria | 22639 |
| 66 | Ga0466705_315203 | 3300042612 | Bacteria | 4354 |
| 67 | Ga0466705_388238 | 3300042612 | Bacteria | 26017 |
| 68 | Ga0466715_049725 | 3300042616 | Bacteria | 2254 |
| 69 | Ga0466715_064135 | 3300042616 | Bacteria | 2924 |
| 70 | Ga0466726_231088 | 3300042619 | Unclassified | 9333 |
| 71 | Ga0466728_109044 | 3300042620 | Bacteria | 2176 |
| 72 | Ga0123356_10895373 | 3300010049 | Bacteria | 1059 |
| 73 | JGI24702J35022_10003718 | 3300002462 | Bacteria | 9170 |
| 74 | Ga0068305_10008962 | 3300005083 | Bacteria | 12406 |
| 75 | Ga0466716_183262 | 3300042605 | Bacteria | 30600 |
| 76 | Ga0466735_005335 | 3300042624 | Bacteria | 1146 |
| 77 | Ga0466708_081429 | 3300042652 | Bacteria | 11682 |
| 78 | Ga0466693_148862 | 3300042592 | Bacteria | 2712 |
| 79 | Ga0466691_005344 | 3300042593 | Bacteria | 6347 |
| 80 | Ga0466691_195041 | 3300042593 | Bacteria | 1306 |
| 81 | Ga0466696_067990 | 3300042596 | Bacteria | 2707 |
| 82 | Ga0466705_006462 | 3300042612 | Bacteria | 1745 |
| 83 | Ga0466711_472730 | 3300042615 | Bacteria | 12402 |
| 84 | Ga0123353_10025707 | 3300010167 | Bacteria | 8977 |
| 85 | 2227222487 | 2225789004 | Bacteria | 7449 |
| 86 | Ga0068302_10039006 | 3300005071 | Bacteria | 4869 |
| 87 | Ga0466707_089583 | 3300042601 | Bacteria | 4464 |
| 88 | Ga0466716_061134 | 3300042605 | Bacteria | 7887 |
| 89 | Ga0466703_104748 | 3300042636 | Bacteria | 7412 |
| 90 | Ga0466704_388102 | 3300042643 | Bacteria | 9893 |
| 91 | Ga0466704_406078 | 3300042643 | Bacteria | 12910 |
| 92 | Ga0466709_127340 | 3300042648 | Bacteria | 4907 |
| 93 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 94 | Ga0466696_008129 | 3300042596 | Bacteria | 20872 |
| 95 | Ga0466696_285470 | 3300042596 | Bacteria | 9607 |
| 96 | Ga0466733_030534 | 3300042659 | Bacteria | 73502 |
| 97 | Ga0466715_112803 | 3300042616 | Bacteria | 21784 |
| 98 | Ga0466728_211840 | 3300042620 | Bacteria | 17235 |
| 99 | Ga0466728_332643 | 3300042620 | Bacteria | 3872 |
| 100 | Ga0123353_10086853 | 3300010167 | Bacteria | 5038 |
| 101 | 2227154967 | 2225789004 | Bacteria | 1574 |
| 102 | Ga0068305_10026751 | 3300005083 | Bacteria | 5845 |
| 103 | Ga0466706_096605 | 3300042599 | Bacteria | 26851 |
| 104 | Ga0466713_155527 | 3300042602 | Bacteria | 13847 |
| 105 | Ga0466735_223553 | 3300042624 | Bacteria | 1112 |
| 106 | Ga0466704_096470 | 3300042643 | Bacteria | 3788 |
| 107 | Ga0466704_111547 | 3300042643 | Bacteria | 3240 |
| 108 | Ga0466704_266456 | 3300042643 | Bacteria | 15104 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.