Protein Family IF05107
Metagenome
Isolate
159
Members
70
Samples
123
Scaffolds
481.69
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_048763|Ga0466696_048763_3662_5233
- Length
- 523 aa
- Sequence
- MKLSELLNIAGLGEISGGNDPEITGVYADSRQVKPGSLFVAVKGTLADGHDYIGKAVEQGAIAILCEHAVDLAEDAVTKATAFAGGDVVVGDEVPASGKSVAGVAYNTSFAGKEIVFFMAPDPAEALGRIASAWYGEPSARMTVVGVTGTNGKTTIATLLYNLFRKLGYKAGLLSTVCNYIDDEAVPTEHTTPDPLTINRLMSRMADAGCEYVFMEVSSHAIDQKRISGLDFNGGIFTNLTRDHLDYHKTVDNYLKTKKKFFDDLPASAFALTNADDKSGPVMLQNTAARKLTYSLRTMADFKGKIMESHFEGMEIDINGHDVYTHFIGRFNASNLLAVYGAAVALGEESEEILVALSTLHPVSGRFETIRSPKGFTAVVDYAHTPDALTNVLNGINEVLEGSGRVITVVGAGGGRDKGKRPLMAKEAVRQSDRLILTSDNPRFEEPDEIINDMVAGLNASDKERTLCITDRRQAIKTAVAFAQKGDVILIAGKGHEDYQDVKGEKHHFDDKEIVREIFNTEN
Sample Types
Isolate
22.6%
Metagenome
77.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
45.7%
Kalotermitidae
20.0%
Termitidae
10.0%
Unclassified
10.0%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Passalidae
2.9%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
159
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 4 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 5 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 6 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 16 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 17 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 18 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 25 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 26 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 27 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 30 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 31 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 32 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 42 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 43 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 44 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 45 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 52 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 53 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 54 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 55 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 60 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 61 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 62 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 63 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 64 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 65 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 66 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 67 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 68 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 69 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_233762 | 3300042616 | Bacteria | 19149 |
| 2 | Ga0466726_450811 | 3300042619 | Bacteria | 4712 |
| 3 | Ga0466706_137590 | 3300042599 | Bacteria | 25056 |
| 4 | Ga0466733_181724 | 3300042659 | Bacteria | 66237 |
| 5 | Ga0466691_075210 | 3300042593 | Bacteria | 24277 |
| 6 | Ga0466696_378568 | 3300042596 | Bacteria | 3700 |
| 7 | 2227108579 | 2225789004 | Bacteria | 38272 |
| 8 | 2227530183 | 2225789004 | Bacteria | 16381 |
| 9 | Ga0068305_10042196 | 3300005083 | Bacteria | 15988 |
| 10 | Ga0466705_004521 | 3300042612 | Bacteria | 9564 |
| 11 | Ga0466735_004868 | 3300042624 | Bacteria | 15556 |
| 12 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 13 | Ga0466704_139994 | 3300042643 | Bacteria | 7248 |
| 14 | Ga0466704_422764 | 3300042643 | Bacteria | 23212 |
| 15 | Ga0466708_196684 | 3300042652 | Bacteria | 22308 |
| 16 | Ga0466715_335119 | 3300042616 | Bacteria | 21011 |
| 17 | Ga0466726_186310 | 3300042619 | Bacteria | 5641 |
| 18 | Ga0466706_011190 | 3300042599 | Bacteria | 34638 |
| 19 | Ga0466706_011465 | 3300042599 | Bacteria | 14456 |
| 20 | Ga0466732_023507 | 3300042656 | Bacteria | 80252 |
| 21 | Ga0466733_035306 | 3300042659 | Bacteria | 102874 |
| 22 | Ga0466690_080563 | 3300042590 | Bacteria | 27019 |
| 23 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 24 | Ga0466696_043628 | 3300042596 | Bacteria | 22568 |
| 25 | Ga0466705_191266 | 3300042612 | Bacteria | 24237 |
| 26 | Ga0466709_197664 | 3300042648 | Bacteria | 8558 |
| 27 | Ga0466725_246022 | 3300042654 | Bacteria | 27455 |
| 28 | Ga0466711_220444 | 3300042615 | Bacteria | 19427 |
| 29 | Ga0466706_002382 | 3300042599 | Bacteria | 3045 |
| 30 | Ga0466706_051828 | 3300042599 | Bacteria | 24965 |
| 31 | Ga0466706_218375 | 3300042599 | Bacteria | 57228 |
| 32 | Ga0466713_035486 | 3300042602 | Bacteria | 12858 |
| 33 | Ga0466713_099964 | 3300042602 | Bacteria | 24145 |
| 34 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 35 | Ga0466719_429770 | 3300042606 | Bacteria | 16643 |
| 36 | Ga0466722_147385 | 3300042609 | Bacteria | 8778 |
| 37 | Ga0466732_080661 | 3300042656 | Bacteria | 5256 |
| 38 | Ga0466733_050745 | 3300042659 | Bacteria | 18476 |
| 39 | Ga0466696_410620 | 3300042596 | Bacteria | 25661 |
| 40 | IMNBL1DRAFT_c0001589 | 3300000062 | Bacteria | 16869 |
| 41 | Ga0466705_029189 | 3300042612 | Bacteria | 2842 |
| 42 | Ga0466735_015542 | 3300042624 | Bacteria | 2335 |
| 43 | Ga0466735_082455 | 3300042624 | Bacteria | 10716 |
| 44 | Ga0466704_320437 | 3300042643 | Bacteria | 10713 |
| 45 | Ga0466711_073849 | 3300042615 | Bacteria | 19235 |
| 46 | Ga0466711_241205 | 3300042615 | Bacteria | 25347 |
| 47 | Ga0466706_193089 | 3300042599 | Bacteria | 58339 |
| 48 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 49 | Ga0466714_101275 | 3300042603 | Bacteria | 2012 |
| 50 | Ga0466733_222052 | 3300042659 | Bacteria | 81292 |
| 51 | Ga0123357_10053426 | 3300009784 | Bacteria | 5451 |
| 52 | Ga0466692_008888 | 3300042591 | Bacteria | 27213 |
| 53 | Ga0466692_192950 | 3300042591 | Bacteria | 19478 |
| 54 | Ga0466691_212492 | 3300042593 | Bacteria | 29583 |
| 55 | 2227544076 | 2225789004 | Bacteria | 15432 |
| 56 | IMNBL1DRAFT_c0009023 | 3300000062 | Bacteria | 4999 |
| 57 | Ga0068305_10004429 | 3300005083 | Bacteria | 74318 |
| 58 | Ga0068305_10047479 | 3300005083 | Bacteria | 8111 |
| 59 | Ga0466704_510642 | 3300042643 | Bacteria | 18412 |
| 60 | Ga0466725_054693 | 3300042654 | Bacteria | 33575 |
| 61 | Ga0466711_196075 | 3300042615 | Bacteria | 21098 |
| 62 | Ga0466723_076286 | 3300042618 | Bacteria | 8324 |
| 63 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 64 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 65 | Ga0466719_042604 | 3300042606 | Bacteria | 12458 |
| 66 | Ga0466733_146065 | 3300042659 | Bacteria | 12551 |
| 67 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 68 | Ga0466696_185074 | 3300042596 | Bacteria | 8022 |
| 69 | Ga0466696_299474 | 3300042596 | Bacteria | 22051 |
| 70 | Ga0466704_041870 | 3300042643 | Bacteria | 10680 |
| 71 | Ga0466705_434662 | 3300042612 | Bacteria | 10118 |
| 72 | Ga0466711_221321 | 3300042615 | Bacteria | 28835 |
| 73 | Ga0466711_426937 | 3300042615 | Bacteria | 4203 |
| 74 | Ga0466723_344968 | 3300042618 | Bacteria | 22473 |
| 75 | Ga0466728_226309 | 3300042620 | Bacteria | 11273 |
| 76 | Ga0466707_137968 | 3300042601 | Bacteria | 35577 |
| 77 | Ga0466707_159669 | 3300042601 | Bacteria | 505639 |
| 78 | Ga0466707_229461 | 3300042601 | Bacteria | 26081 |
| 79 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 80 | Ga0466713_043835 | 3300042602 | Bacteria | 33934 |
| 81 | Ga0466713_119808 | 3300042602 | Bacteria | 48294 |
| 82 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 83 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 84 | Ga0466698_454723 | 3300042610 | Bacteria | 4354 |
| 85 | Ga0466690_165942 | 3300042590 | Bacteria | 42807 |
| 86 | Ga0466696_025150 | 3300042596 | Bacteria | 5175 |
| 87 | IMNBL1DRAFT_c0001729 | 3300000062 | Bacteria | 16026 |
| 88 | Ga0466735_125124 | 3300042624 | Bacteria | 3753 |
| 89 | Ga0466703_288873 | 3300042636 | Bacteria | 2780 |
| 90 | Ga0466704_137465 | 3300042643 | Bacteria | 13412 |
| 91 | Ga0466704_312751 | 3300042643 | Bacteria | 10651 |
| 92 | Ga0466709_056442 | 3300042648 | Bacteria | 70841 |
| 93 | Ga0466708_293328 | 3300042652 | Bacteria | 56768 |
| 94 | Ga0466708_431015 | 3300042652 | Bacteria | 60350 |
| 95 | Ga0466727_148601 | 3300042655 | Bacteria | 6313 |
| 96 | Ga0466715_340014 | 3300042616 | Bacteria | 11262 |
| 97 | Ga0466723_276908 | 3300042618 | Bacteria | 21481 |
| 98 | Ga0466706_088248 | 3300042599 | Bacteria | 22894 |
| 99 | Ga0466706_233154 | 3300042599 | Bacteria | 17851 |
| 100 | Ga0466707_035097 | 3300042601 | Bacteria | 8598 |
| 101 | Ga0466713_156423 | 3300042602 | Bacteria | 30043 |
| 102 | Ga0466716_333892 | 3300042605 | Bacteria | 18676 |
| 103 | Ga0466733_201766 | 3300042659 | Bacteria | 18252 |
| 104 | Ga0466691_071799 | 3300042593 | Bacteria | 28796 |
| 105 | Ga0466696_048763 | 3300042596 | Bacteria | 5255 |
| 106 | 2227425264 | 2225789004 | Bacteria | 5592 |
| 107 | Ga0068305_10112672 | 3300005083 | Bacteria | 7799 |
| 108 | Ga0466729_203041 | 3300042621 | Bacteria | 16265 |
| 109 | Ga0466703_021603 | 3300042636 | Bacteria | 26593 |
| 110 | Ga0466704_174538 | 3300042643 | Bacteria | 20210 |
| 111 | Ga0466715_078929 | 3300042616 | Bacteria | 42957 |
| 112 | Ga0466726_079499 | 3300042619 | Bacteria | 13489 |
| 113 | Ga0466707_272065 | 3300042601 | Bacteria | 2423 |
| 114 | Ga0466716_149833 | 3300042605 | Bacteria | 35494 |
| 115 | Ga0123356_10045025 | 3300010049 | Bacteria | 4106 |
| 116 | 2227266896 | 2225789004 | Bacteria | 6961 |
| 117 | IMNBL1DRAFT_c0000216 | 3300000062 | Bacteria | 50594 |
| 118 | Ga0466705_119745 | 3300042612 | Bacteria | 31799 |
| 119 | Ga0466705_359873 | 3300042612 | Bacteria | 14759 |
| 120 | Ga0466735_129957 | 3300042624 | Bacteria | 3100 |
| 121 | Ga0466703_162819 | 3300042636 | Bacteria | 2717 |
| 122 | Ga0466703_395996 | 3300042636 | Bacteria | 28558 |
| 123 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.