Protein Family IF05101
Metagenome
Isolate
154
Members
47
Samples
146
Scaffolds
87.48
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_031445|Ga0466696_031445_2992_3300
- Length
- 102 aa
- Sequence
- VELYGSYDPGEAGKNMKILEVKDVTRKDVPIYYRRFYTGIAVMELINKTVEAVIDFSIEIKPTGPKEILINFLDKVDYPLIPLKKELKDLLDRMDSTGELPV
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.6%
Kalotermitidae
31.8%
Unclassified
20.5%
Termopsidae
6.8%
Rhinotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 14 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 35 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 43 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 44 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_144176 | 3300042606 | Bacteria | 32253 |
| 2 | Ga0466720_178145 | 3300042607 | Bacteria | 1769 |
| 3 | Ga0466711_422683 | 3300042615 | Bacteria | 2214 |
| 4 | Ga0466715_303816 | 3300042616 | Bacteria | 14455 |
| 5 | Ga0466718_092660 | 3300042617 | Bacteria | 3600 |
| 6 | Ga0466726_062662 | 3300042619 | Bacteria | 3492 |
| 7 | Ga0466728_102746 | 3300042620 | Bacteria | 2602 |
| 8 | JGI24695J34938_10007709 | 3300002450 | Bacteria | 6244 |
| 9 | JGI24695J34938_10014319 | 3300002450 | Bacteria | 4115 |
| 10 | JGI24702J35022_10060254 | 3300002462 | Bacteria | 2029 |
| 11 | JGI24705J35276_11847352 | 3300002504 | Bacteria | 713 |
| 12 | Ga0466705_038472 | 3300042612 | Bacteria | 21059 |
| 13 | Ga0466705_234948 | 3300042612 | Bacteria | 8944 |
| 14 | Ga0466735_100953 | 3300042624 | Bacteria | 12211 |
| 15 | Ga0123356_10373702 | 3300010049 | Bacteria | 1556 |
| 16 | Ga0123356_11964985 | 3300010049 | Bacteria | 729 |
| 17 | Ga0466692_003856 | 3300042591 | Bacteria | 11624 |
| 18 | Ga0466691_133259 | 3300042593 | Bacteria | 7180 |
| 19 | Ga0466691_133837 | 3300042593 | Bacteria | 9141 |
| 20 | Ga0466694_297645 | 3300042594 | Bacteria | 1201 |
| 21 | Ga0466699_437490 | 3300042597 | Bacteria | 2183 |
| 22 | Ga0466732_352220 | 3300042656 | Unclassified | 3304 |
| 23 | Ga0466720_217810 | 3300042607 | Bacteria | 9912 |
| 24 | Ga0466715_148323 | 3300042616 | Bacteria | 3793 |
| 25 | Ga0466723_252971 | 3300042618 | Bacteria | 1183 |
| 26 | Ga0466726_034345 | 3300042619 | Bacteria | 17460 |
| 27 | Ga0466728_235690 | 3300042620 | Bacteria | 8626 |
| 28 | JGI24698J34947_10298966 | 3300002449 | Bacteria | 581 |
| 29 | JGI24695J34938_10007648 | 3300002450 | Bacteria | 6281 |
| 30 | Ga0074263_101332 | 3300005485 | Bacteria | 1877 |
| 31 | Ga0466704_011268 | 3300042643 | Bacteria | 25139 |
| 32 | Ga0466704_118862 | 3300042643 | Bacteria | 16675 |
| 33 | Ga0466704_473977 | 3300042643 | Bacteria | 23964 |
| 34 | Ga0466692_154744 | 3300042591 | Bacteria | 5993 |
| 35 | Ga0466693_303364 | 3300042592 | Bacteria | 5038 |
| 36 | Ga0466694_289868 | 3300042594 | Bacteria | 1509 |
| 37 | Ga0466699_080963 | 3300042597 | Bacteria | 1417 |
| 38 | Ga0466699_262757 | 3300042597 | Bacteria | 2410 |
| 39 | Ga0466699_334582 | 3300042597 | Unclassified | 5483 |
| 40 | Ga0466699_444056 | 3300042597 | Bacteria | 8338 |
| 41 | Ga0466732_024754 | 3300042656 | Bacteria | 1743 |
| 42 | Ga0466720_039802 | 3300042607 | Bacteria | 11163 |
| 43 | Ga0466718_004638 | 3300042617 | Bacteria | 24050 |
| 44 | Ga0466718_033388 | 3300042617 | Bacteria | 14281 |
| 45 | Ga0466703_094356 | 3300042636 | Bacteria | 13418 |
| 46 | Ga0466709_076525 | 3300042648 | Bacteria | 12746 |
| 47 | Ga0466708_103759 | 3300042652 | Bacteria | 5985 |
| 48 | Ga0466708_170404 | 3300042652 | Bacteria | 4071 |
| 49 | Ga0123356_13043975 | 3300010049 | Bacteria | 585 |
| 50 | Ga0123353_10087712 | 3300010167 | Bacteria | 5011 |
| 51 | Ga0466692_187947 | 3300042591 | Bacteria | 1033 |
| 52 | Ga0466693_192043 | 3300042592 | Bacteria | 8421 |
| 53 | Ga0466694_232046 | 3300042594 | Bacteria | 1361 |
| 54 | Ga0466696_465596 | 3300042596 | Unclassified | 2362 |
| 55 | Ga0466699_331797 | 3300042597 | Bacteria | 3781 |
| 56 | Ga0466701_001700 | 3300042598 | Bacteria | 1334 |
| 57 | Ga0466719_149280 | 3300042606 | Bacteria | 6009 |
| 58 | AustNasuHG_c1059269 | 3300000089 | Bacteria | 751 |
| 59 | FAAS_10657565 | 3300001880 | Bacteria | 536 |
| 60 | JGI24698J34947_10038545 | 3300002449 | Bacteria | 2478 |
| 61 | Ga0466705_003616 | 3300042612 | Bacteria | 15625 |
| 62 | Ga0466703_244349 | 3300042636 | Bacteria | 13637 |
| 63 | Ga0466704_239661 | 3300042643 | Bacteria | 53688 |
| 64 | Ga0123355_10147440 | 3300009826 | Bacteria | 3584 |
| 65 | Ga0123356_10001613 | 3300010049 | Bacteria | 24733 |
| 66 | Ga0123356_10002113 | 3300010049 | Bacteria | 21429 |
| 67 | Ga0123356_10658127 | 3300010049 | Bacteria | 1215 |
| 68 | Ga0466692_138087 | 3300042591 | Bacteria | 1032 |
| 69 | Ga0466693_405235 | 3300042592 | Bacteria | 9545 |
| 70 | Ga0466691_155341 | 3300042593 | Bacteria | 8143 |
| 71 | Ga0466696_279885 | 3300042596 | Bacteria | 1388 |
| 72 | Ga0466696_437602 | 3300042596 | Bacteria | 12376 |
| 73 | Ga0466699_004462 | 3300042597 | Bacteria | 57714 |
| 74 | Ga0466699_234122 | 3300042597 | Bacteria | 1198 |
| 75 | Ga0466699_263841 | 3300042597 | Bacteria | 3202 |
| 76 | Ga0466699_293350 | 3300042597 | Bacteria | 11047 |
| 77 | Ga0466699_355360 | 3300042597 | Bacteria | 2273 |
| 78 | Ga0466732_206748 | 3300042656 | Bacteria | 33874 |
| 79 | Ga0466711_094892 | 3300042615 | Bacteria | 21125 |
| 80 | Ga0466726_063115 | 3300042619 | Bacteria | 1308 |
| 81 | JGI24695J34938_10051124 | 3300002450 | Bacteria | 1810 |
| 82 | Ga0466703_048944 | 3300042636 | Bacteria | 1086 |
| 83 | Ga0123353_10907966 | 3300010167 | Bacteria | 1198 |
| 84 | Ga0466692_083091 | 3300042591 | Bacteria | 2359 |
| 85 | Ga0466692_116465 | 3300042591 | Bacteria | 19396 |
| 86 | Ga0466696_233847 | 3300042596 | Bacteria | 11876 |
| 87 | Ga0466696_255031 | 3300042596 | Unclassified | 2143 |
| 88 | Ga0466696_279796 | 3300042596 | Unclassified | 2106 |
| 89 | Ga0466716_106786 | 3300042605 | Bacteria | 35327 |
| 90 | Ga0466719_547503 | 3300042606 | Bacteria | 1248 |
| 91 | Ga0466705_425651 | 3300042612 | Bacteria | 1259 |
| 92 | Ga0466715_059303 | 3300042616 | Bacteria | 8334 |
| 93 | Ga0466715_477796 | 3300042616 | Bacteria | 17116 |
| 94 | Ga0466718_033746 | 3300042617 | Bacteria | 2859 |
| 95 | Ga0466723_120220 | 3300042618 | Bacteria | 2797 |
| 96 | Ga0466728_455662 | 3300042620 | Bacteria | 6895 |
| 97 | JGI24698J34947_10021872 | 3300002449 | Bacteria | 3435 |
| 98 | JGI24698J34947_10031253 | 3300002449 | Bacteria | 2804 |
| 99 | JGI24695J34938_10003043 | 3300002450 | Bacteria | 12026 |
| 100 | Ga0123356_12523347 | 3300010049 | Bacteria | 643 |
| 101 | Ga0123356_12549036 | 3300010049 | Bacteria | 640 |
| 102 | Ga0123356_12747866 | 3300010049 | Bacteria | 616 |
| 103 | Ga0123353_12585778 | 3300010167 | Bacteria | 601 |
| 104 | Ga0264413_123898 | 3300024493 | Bacteria | 4434 |
| 105 | Ga0415639_018117 | 3300038395 | Bacteria | 21951 |
| 106 | Ga0466690_174407 | 3300042590 | Bacteria | 3112 |
| 107 | Ga0466691_222105 | 3300042593 | Bacteria | 8706 |
| 108 | Ga0466696_231225 | 3300042596 | Bacteria | 5744 |
| 109 | Ga0466699_063680 | 3300042597 | Bacteria | 13141 |
| 110 | Ga0466732_133919 | 3300042656 | Unclassified | 1024 |
| 111 | Ga0466713_143214 | 3300042602 | Bacteria | 1560 |
| 112 | Ga0466719_470329 | 3300042606 | Bacteria | 5862 |
| 113 | Ga0466720_022123 | 3300042607 | Bacteria | 1194 |
| 114 | Ga0466715_021799 | 3300042616 | Bacteria | 20987 |
| 115 | Ga0466715_252975 | 3300042616 | Bacteria | 10555 |
| 116 | Ga0466723_105234 | 3300042618 | Bacteria | 9521 |
| 117 | AustNasuHG_c1010155 | 3300000089 | Bacteria | 3286 |
| 118 | JGI24698J34947_10030734 | 3300002449 | Bacteria | 2831 |
| 119 | JGI24695J34938_10022191 | 3300002450 | Bacteria | 3088 |
| 120 | JGI24695J34938_10052352 | 3300002450 | Bacteria | 1781 |
| 121 | JGI24695J34938_10126587 | 3300002450 | Bacteria | 1041 |
| 122 | Ga0072941_1046872 | 3300005201 | Bacteria | 6109 |
| 123 | Ga0466703_099911 | 3300042636 | Bacteria | 4123 |
| 124 | Ga0466704_237034 | 3300042643 | Bacteria | 17852 |
| 125 | Ga0466709_418869 | 3300042648 | Bacteria | 3404 |
| 126 | Ga0466708_093813 | 3300042652 | Bacteria | 1428 |
| 127 | Ga0466727_098262 | 3300042655 | Bacteria | 4210 |
| 128 | Ga0123355_10008175 | 3300009826 | Bacteria | 15799 |
| 129 | Ga0264413_108977 | 3300024493 | Bacteria | 3330 |
| 130 | Ga0466693_096673 | 3300042592 | Unclassified | 6469 |
| 131 | Ga0466694_031771 | 3300042594 | Bacteria | 1217 |
| 132 | Ga0466720_055497 | 3300042607 | Bacteria | 6491 |
| 133 | Ga0466715_062632 | 3300042616 | Bacteria | 11333 |
| 134 | JGI24695J34938_10000924 | 3300002450 | Bacteria | 26865 |
| 135 | JGI24695J34938_10003053 | 3300002450 | Bacteria | 11995 |
| 136 | JGI24695J34938_10042884 | 3300002450 | Bacteria | 2022 |
| 137 | JGI24702J35022_10001877 | 3300002462 | Bacteria | 12931 |
| 138 | Ga0466703_232900 | 3300042636 | Bacteria | 8550 |
| 139 | Ga0466704_016291 | 3300042643 | Bacteria | 18399 |
| 140 | Ga0123355_10000434 | 3300009826 | Bacteria | 54971 |
| 141 | Ga0264413_139815 | 3300024493 | Bacteria | 3462 |
| 142 | Ga0466690_408423 | 3300042590 | Bacteria | 1733 |
| 143 | Ga0466696_031445 | 3300042596 | Archaea | 3465 |
| 144 | Ga0466699_075077 | 3300042597 | Bacteria | 1312 |
| 145 | Ga0466699_126849 | 3300042597 | Bacteria | 15271 |
| 146 | Ga0466699_234070 | 3300042597 | Bacteria | 16195 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.