Protein Family IF05094
Metagenome
Isolate
234
Members
100
Samples
110
Scaffolds
360.82
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_014162|Ga0466696_014162_660_1898
- Length
- 412 aa
- Sequence
- LLLQKDKISFNPLNYQKMSLETKVIKSRLGLLGLAEELGNVSRACKYLGYSRDTFYRYKELFDEGGEIALKDMNRRVPNVKNRIEPLIEEQVVAYATDNPALGQVRVSNELKKKGVFISPCGVRCVWLRHDLETFPKRLKALEAKVAQEGLILTESQVVALEKAKEEKVAKGEIETHHPGYLGAQDTYYVGYIKGVGKIYQQTFIDTYAKVAFAKLYDRKIALTAADMLNDKVIPLYDSYQLPLMRVLTDRGTEYCGAREHHEYQLYLAIEDIDHTKTKAKSPQTNGICERFHRTMQDEFYATAFRKKIYTSLEELQADVDLWIEHYNNERTHSGRYCYGKTPMQTWNESLHLAKDKLLNNQYQNFVPLHVSGKEEAGSAEEQPASNSLADWNGQGGQNPPYNNLIIPRNYG
Sample Types
Isolate
53.0%
Metagenome
47.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.0%
Blattidae
16.0%
Apidae
12.0%
Drosophilidae
9.0%
Kalotermitidae
7.0%
Unclassified
6.0%
Culicidae
6.0%
Coreidae
4.0%
Formicidae
2.0%
Passalidae
2.0%
Aphididae
1.0%
Rhinotermitidae
1.0%
Largidae
1.0%
Carposinidae
1.0%
Termopsidae
1.0%
Taxonomy
Archaea
1
Bacteria
214
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 2 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 3 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 4 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 14 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 15 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 18 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 22 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 23 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 24 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 25 | 638341232 | Wolbachia endosymbiont of Drosophila ananassae | Isolate | Drosophilidae |
| 26 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 29 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 30 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 31 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 32 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 33 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 34 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 35 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 36 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 37 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 38 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 39 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 48 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 49 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 50 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 51 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 52 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 53 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 54 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 55 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 56 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 57 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 58 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 59 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 60 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 61 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 62 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 66 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 67 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 68 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 69 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 70 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 71 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 72 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 73 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 74 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 75 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 76 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 77 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 78 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 79 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 80 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 81 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 82 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 85 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 86 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 87 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 88 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 89 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 90 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 91 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 92 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 93 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 94 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 95 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 96 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 97 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 98 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 99 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 100 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10292583 | 3300009784 | Bacteria | 1660 |
| 2 | Ga0123356_10497888 | 3300010049 | Bacteria | 1374 |
| 3 | Ga0123353_10649843 | 3300010167 | Bacteria | 1493 |
| 4 | Ga0123353_10685661 | 3300010167 | Bacteria | 1442 |
| 5 | Ga0466694_001567 | 3300042594 | Bacteria | 2445 |
| 6 | Ga0466710_010882 | 3300042613 | Bacteria | 12242 |
| 7 | Ga0466712_094848 | 3300042614 | Unclassified | 2264 |
| 8 | Ga0466700_433032 | 3300042600 | Bacteria | 1507 |
| 9 | Ga0466716_057161 | 3300042605 | Bacteria | 1627 |
| 10 | 2227572159 | 2225789004 | Bacteria | 2601 |
| 11 | Meta3P_1002241 | 3300002464 | Bacteria | 16611 |
| 12 | Ga0074188_1000721 | 3300005318 | Bacteria | 9891 |
| 13 | Ga0466709_077447 | 3300042648 | Bacteria | 1821 |
| 14 | Ga0123356_10555185 | 3300010049 | Bacteria | 1310 |
| 15 | Ga0123353_10478744 | 3300010167 | Unclassified | 1822 |
| 16 | Ga0123353_10714754 | 3300010167 | Bacteria | 1403 |
| 17 | Ga0466693_200356 | 3300042592 | Bacteria | 2109 |
| 18 | Ga0466695_254427 | 3300042595 | Bacteria | 1444 |
| 19 | Ga0466718_131916 | 3300042617 | Bacteria | 1619 |
| 20 | Ga0466721_205626 | 3300042608 | Unclassified | 1560 |
| 21 | JGI24705J35276_12160665 | 3300002504 | Bacteria | 1231 |
| 22 | Ga0074309_1093745 | 3300005314 | Unclassified | 2056 |
| 23 | Ga0102738_1003951 | 3300007141 | Bacteria | 2134 |
| 24 | Ga0104040_1143529 | 3300007149 | Bacteria | 2002 |
| 25 | Ga0466697_108700 | 3300042611 | Bacteria | 2159 |
| 26 | Ga0466725_315598 | 3300042654 | Bacteria | 1728 |
| 27 | Ga0123356_10120264 | 3300010049 | Unclassified | 2553 |
| 28 | Ga0123353_10823222 | 3300010167 | Unclassified | 1278 |
| 29 | Ga0466693_185665 | 3300042592 | Unclassified | 1499 |
| 30 | Ga0466694_175521 | 3300042594 | Bacteria | 1561 |
| 31 | Ga0466714_131006 | 3300042603 | Bacteria | 1587 |
| 32 | JGI24695J34938_10089587 | 3300002450 | Bacteria | 1263 |
| 33 | JGI24696J40584_12922995 | 3300002834 | Bacteria | 1371 |
| 34 | Ga0466733_139738 | 3300042659 | Bacteria | 2705 |
| 35 | Ga0466695_089124 | 3300042595 | Bacteria | 1540 |
| 36 | Ga0466696_495560 | 3300042596 | Unclassified | 1570 |
| 37 | Ga0466714_071375 | 3300042603 | Bacteria | 1411 |
| 38 | Ga0466717_119339 | 3300042604 | Unclassified | 1895 |
| 39 | Ga0466717_267889 | 3300042604 | Bacteria | 1752 |
| 40 | Ga0466720_094955 | 3300042607 | Bacteria | 1619 |
| 41 | Ga0466721_397430 | 3300042608 | Bacteria | 1628 |
| 42 | JGI24695J34938_10006592 | 3300002450 | Bacteria | 6935 |
| 43 | JGI24695J34938_10034456 | 3300002450 | Bacteria | 2323 |
| 44 | JGI24695J34938_10083282 | 3300002450 | Unclassified | 1319 |
| 45 | JGI24705J35276_12192264 | 3300002504 | Bacteria | 1485 |
| 46 | Ga0466732_005641 | 3300042656 | Bacteria | 25741 |
| 47 | Ga0466732_236895 | 3300042656 | Bacteria | 1921 |
| 48 | Ga0466731_039179 | 3300042622 | Unclassified | 1166 |
| 49 | Ga0123353_10232418 | 3300010167 | Bacteria | 2873 |
| 50 | Ga0466657_376925 | 3300042582 | Bacteria | 1440 |
| 51 | Ga0466694_185427 | 3300042594 | Bacteria | 2143 |
| 52 | Ga0466710_345463 | 3300042613 | Bacteria | 1291 |
| 53 | Ga0466712_102540 | 3300042614 | Bacteria | 20390 |
| 54 | Ga0466714_045169 | 3300042603 | Bacteria | 1473 |
| 55 | Ga0466717_061362 | 3300042604 | Bacteria | 1331 |
| 56 | Ga0466719_274944 | 3300042606 | Bacteria | 1163 |
| 57 | Nasutiter_Contig03146 | 2030936001 | Bacteria | 1858 |
| 58 | Ga0104041_1117116 | 3300007106 | Unclassified | 1220 |
| 59 | Ga0466732_331140 | 3300042656 | Bacteria | 1502 |
| 60 | Ga0466731_010446 | 3300042622 | Bacteria | 4094 |
| 61 | Ga0466730_052573 | 3300042625 | Bacteria | 1464 |
| 62 | Ga0466730_058791 | 3300042625 | Bacteria | 120456 |
| 63 | Ga0466702_339190 | 3300042635 | Bacteria | 1401 |
| 64 | Ga0466708_321687 | 3300042652 | Bacteria | 2184 |
| 65 | Ga0123357_10350878 | 3300009784 | Bacteria | 1412 |
| 66 | Ga0123355_10549443 | 3300009826 | Unclassified | 1397 |
| 67 | Ga0415639_142972 | 3300038395 | Bacteria | 2657 |
| 68 | Ga0466693_420218 | 3300042592 | Bacteria | 1250 |
| 69 | Ga0466696_014162 | 3300042596 | Bacteria | 1947 |
| 70 | Ga0466696_200370 | 3300042596 | Bacteria | 2015 |
| 71 | Ga0466696_319510 | 3300042596 | Bacteria | 1916 |
| 72 | Ga0466710_374317 | 3300042613 | Bacteria | 1860 |
| 73 | Ga0466712_033147 | 3300042614 | Archaea | 2472 |
| 74 | Ga0466712_141906 | 3300042614 | Unclassified | 1354 |
| 75 | Ga0466718_125702 | 3300042617 | Unclassified | 2098 |
| 76 | Ga0466728_316105 | 3300042620 | Bacteria | 1418 |
| 77 | Ga0466701_085305 | 3300042598 | Bacteria | 1595 |
| 78 | Ga0466714_162460 | 3300042603 | Bacteria | 3612 |
| 79 | Ga0466719_474919 | 3300042606 | Bacteria | 2230 |
| 80 | Ga0466698_130454 | 3300042610 | Bacteria | 1356 |
| 81 | Ga0105005_1021073 | 3300007505 | Bacteria | 11631 |
| 82 | Ga0466732_118272 | 3300042656 | Bacteria | 1348 |
| 83 | Ga0466735_058389 | 3300042624 | Bacteria | 3489 |
| 84 | Ga0466725_076794 | 3300042654 | Bacteria | 2135 |
| 85 | Ga0123356_10555842 | 3300010049 | Bacteria | 1309 |
| 86 | Ga0123354_10275551 | 3300010882 | Bacteria | 1646 |
| 87 | Ga0309901_1019404 | 3300028918 | Unclassified | 1472 |
| 88 | Ga0466693_146852 | 3300042592 | Bacteria | 1749 |
| 89 | Ga0466691_005117 | 3300042593 | Bacteria | 17172 |
| 90 | Ga0466694_044305 | 3300042594 | Bacteria | 1773 |
| 91 | Ga0466729_058903 | 3300042621 | Bacteria | 2944 |
| 92 | Ga0466701_060869 | 3300042598 | Bacteria | 1554 |
| 93 | Ga0466721_178220 | 3300042608 | Bacteria | 1922 |
| 94 | Ga0466697_167097 | 3300042611 | Bacteria | 1786 |
| 95 | Ga0466731_173529 | 3300042622 | Unclassified | 1339 |
| 96 | Ga0466731_284903 | 3300042622 | Bacteria | 1441 |
| 97 | Ga0466731_433455 | 3300042622 | Bacteria | 1371 |
| 98 | Ga0466730_040075 | 3300042625 | Bacteria | 1363 |
| 99 | Ga0123355_10654584 | 3300009826 | Bacteria | 1225 |
| 100 | Ga0123356_10068394 | 3300010049 | Bacteria | 3327 |
| 101 | Ga0123356_10082133 | 3300010049 | Unclassified | 3050 |
| 102 | Ga0466657_126364 | 3300042582 | Bacteria | 1247 |
| 103 | Ga0466701_011586 | 3300042598 | Bacteria | 1476 |
| 104 | Ga0466712_005661 | 3300042614 | Bacteria | 10779 |
| 105 | Ga0466701_026150 | 3300042598 | Bacteria | 1622 |
| 106 | Ga0466717_290810 | 3300042604 | Bacteria | 2068 |
| 107 | Ga0466698_326728 | 3300042610 | Bacteria | 1494 |
| 108 | IMNBL1DRAFT_c0031572 | 3300000062 | Bacteria | 1924 |
| 109 | JGI24695J34938_10033660 | 3300002450 | Unclassified | 2356 |
| 110 | Ga0104042_1036877 | 3300007130 | Bacteria | 1201 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13683 | GO:0015074 | DNA integration | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.