Protein Family IF05083

Metagenome Isolate
118 Members
35 Samples
107 Scaffolds
212.96 Avg Length

🧬 Representative Sequence

ID
3300042595|Ga0466695_310938|Ga0466695_310938_3207_3959
Length
250 aa
Sequence
MKKALSLSKQCRQIILLGLFFCAVNGAGDSMDLAQNFDTDRNRMVEEQLIPRKIKSKAVLGAMRDVPRHIFVPEEMRSVAYADTPLPIGLGQTISQPYIVAFMTEQISPEPGMKILEIGTGSGYQAAILAYLGCEVFTIELLEELAAKAKQILGSLKFDNVIARHGDGYEGWPEAAPFDAIIVTAAPDYMPQKLVEQLKDGGKMIIPVGDVHSLQFLKLVTKKGNKTIEKDLLPVRFVPMVETAPKPKVR

πŸ“Š Sample Types

Isolate 9.3%
Metagenome 90.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 67.6%
Unclassified 26.5%
Aphrophoridae 2.9%
Glossinidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 2585428135 Sodalis-like symbiont of Philaenus spumarius PSPU Isolate Aphrophoridae
5 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
18 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
22 2820852808 Unclassified Actinobacteria Lab288P3bin25 Isolate Unclassified
23 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
24 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 2820874551 Unclassified Actinobacteria Lab288P1bin85 Isolate Unclassified
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
32 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
33 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
34 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_021473 3300038395 Bacteria 4391
2 Ga0466656_142987 3300042550 Bacteria 1491
3 Ga0466701_005173 3300042598 Bacteria 1003
4 Ga0466721_143465 3300042608 Bacteria 13673
5 Ga0123356_10080831 3300010049 Bacteria 3074
6 Ga0123356_10837985 3300010049 Bacteria 1091
7 Ga0123356_10845574 3300010049 Bacteria 1086
8 Ga0123353_10643789 3300010167 Bacteria 1502
9 Ga0466710_224662 3300042613 Bacteria 26778
10 Ga0466731_356403 3300042622 Bacteria 1421
11 Ga0466731_398204 3300042622 Bacteria 7225
12 Ga0466734_173525 3300042623 Bacteria 5490
13 Ga0466702_406924 3300042635 Bacteria 1145
14 Ga0466725_020295 3300042654 Bacteria 3292
15 Ga0466695_016622 3300042595 Bacteria 1315
16 Ga0123356_10079064 3300010049 Bacteria 3106
17 Ga0123356_10722571 3300010049 Bacteria 1165
18 Ga0123353_10018185 3300010167 Bacteria 10379
19 Ga0123353_10328991 3300010167 Bacteria 2314
20 Ga0123353_10699149 3300010167 Bacteria 1423
21 JGI24702J35022_10007301 3300002462 Bacteria 6342
22 JGI24702J35022_10018197 3300002462 Bacteria 3832
23 Ga0466731_379732 3300042622 Bacteria 31002
24 Ga0466725_076219 3300042654 Bacteria 3967
25 Ga0415639_001599 3300038395 Bacteria 3294
26 Ga0466695_310938 3300042595 Bacteria 4667
27 Ga0466717_198600 3300042604 Bacteria 1107
28 Ga0466721_091188 3300042608 Bacteria 1100
29 Ga0123356_10148119 3300010049 Bacteria 2326
30 Ga0123356_10268076 3300010049 Bacteria 1795
31 Ga0123356_10651721 3300010049 Bacteria 1220
32 Ga0123356_11819937 3300010049 Bacteria 757
33 Ga0123356_11875692 3300010049 Bacteria 746
34 Ga0123353_11442508 3300010167 Bacteria 881
35 JGI24698J34947_10001965 3300002449 Bacteria 10965
36 Ga0415639_079878 3300038395 Bacteria 1032
37 Ga0466657_370180 3300042582 Bacteria 4736
38 Ga0466694_188859 3300042594 Bacteria 5582
39 Ga0466695_119336 3300042595 Bacteria 2031
40 Ga0123355_10848227 3300009826 Bacteria 1006
41 Ga0123356_10000943 3300010049 Bacteria 32172
42 Ga0123356_10089472 3300010049 Bacteria 2929
43 Ga0123356_10300903 3300010049 Bacteria 1709
44 Ga0123356_10307418 3300010049 Bacteria 1693
45 Ga0123356_10357915 3300010049 Bacteria 1585
46 Ga0123353_10110760 3300010167 Bacteria 4423
47 Ga0123353_10528748 3300010167 Bacteria 1708
48 Ga0123353_10660545 3300010167 Bacteria 1477
49 JGI24702J35022_10001722 3300002462 Bacteria 13558
50 Ga0466712_222325 3300042614 Bacteria 22719
51 Ga0466731_167414 3300042622 Bacteria 1125
52 Ga0466725_080646 3300042654 Bacteria 5471
53 Ga0466695_174812 3300042595 Bacteria 1227
54 Ga0123356_10029953 3300010049 Bacteria 5095
55 Ga0123356_10036960 3300010049 Bacteria 4558
56 Ga0123356_10067201 3300010049 Bacteria 3358
57 Ga0123356_10289670 3300010049 Bacteria 1737
58 Ga0123356_10457359 3300010049 Unclassified 1425
59 Ga0123356_10998551 3300010049 Bacteria 1007
60 Ga0123353_10196077 3300010167 Bacteria 3183
61 Ga0123353_10445238 3300010167 Bacteria 1909
62 Ga0123353_11084267 3300010167 Bacteria 1065
63 Ga0123354_10038253 3300010882 Unclassified 7451
64 Ga0466697_164821 3300042611 Bacteria 1517
65 Ga0123355_10127430 3300009826 Bacteria 3930
66 Ga0123355_10261251 3300009826 Bacteria 2421
67 Ga0123356_10010771 3300010049 Bacteria 8947
68 Ga0123356_10035532 3300010049 Bacteria 4655
69 Ga0123356_10037513 3300010049 Bacteria 4520
70 Ga0123356_10091231 3300010049 Bacteria 2903
71 Ga0123356_10136479 3300010049 Bacteria 2412
72 Ga0123356_10242169 3300010049 Bacteria 1875
73 Ga0123356_10289153 3300010049 Bacteria 1738
74 Ga0123356_11293001 3300010049 Bacteria 893
75 Ga0123353_10230403 3300010167 Bacteria 2889
76 JGI24702J35022_10000069 3300002462 Bacteria 44707
77 JGI24702J35022_10030465 3300002462 Bacteria 2895
78 Ga0466718_164171 3300042617 Bacteria 1440
79 Ga0466725_125057 3300042654 Bacteria 6799
80 Ga0264413_127246 3300024493 Unclassified 5775
81 Ga0466657_012444 3300042582 Bacteria 321104
82 Ga0466700_412365 3300042600 Unclassified 1831
83 Ga0123356_10373221 3300010049 Bacteria 1557
84 Ga0123356_11169813 3300010049 Bacteria 936
85 Ga0123353_10201973 3300010167 Bacteria 3126
86 Ga0123353_10362954 3300010167 Bacteria 2175
87 Ga0123353_10537617 3300010167 Bacteria 1690
88 Ga0123353_10679964 3300010167 Bacteria 1450
89 Ga0123354_10597556 3300010882 Bacteria 810
90 JGI24702J35022_10081785 3300002462 Bacteria 1750
91 Ga0466725_384599 3300042654 Bacteria 29241
92 Ga0415639_008408 3300038395 Bacteria 3202
93 Ga0415639_267557 3300038395 Bacteria 1120
94 Ga0466657_214089 3300042582 Bacteria 4518
95 Ga0466657_284204 3300042582 Bacteria 1513
96 Ga0466695_283245 3300042595 Archaea 1107
97 Ga0123355_10001344 3300009826 Bacteria 34139
98 Ga0123355_10076444 3300009826 Unclassified 5355
99 Ga0123356_10054756 3300010049 Bacteria 3715
100 Ga0123356_10110736 3300010049 Bacteria 2652
101 Ga0123356_10618197 3300010049 Bacteria 1249
102 Ga0123356_10771369 3300010049 Bacteria 1132
103 Ga0123353_11323229 3300010167 Bacteria 933
104 JGI24702J35022_10094812 3300002462 Bacteria 1628
105 JGI24702J35022_10141545 3300002462 Bacteria 1342
106 Ga0466712_012143 3300042614 Bacteria 4944
107 Ga0466731_102439 3300042622 Bacteria 2364

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 42 242 0.94
PF13489 Methyltransf_23 Methyltransferase domain 108 185 0.87
PF13649 Methyltransf_25 Methyltransferase domain 115 194 0.86
PF13847 Methyltransf_31 Methyltransferase domain 110 208 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.