Protein Family IF05083
Metagenome
Isolate
118
Members
35
Samples
107
Scaffolds
212.96
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_310938|Ga0466695_310938_3207_3959
- Length
- 250 aa
- Sequence
- MKKALSLSKQCRQIILLGLFFCAVNGAGDSMDLAQNFDTDRNRMVEEQLIPRKIKSKAVLGAMRDVPRHIFVPEEMRSVAYADTPLPIGLGQTISQPYIVAFMTEQISPEPGMKILEIGTGSGYQAAILAYLGCEVFTIELLEELAAKAKQILGSLKFDNVIARHGDGYEGWPEAAPFDAIIVTAAPDYMPQKLVEQLKDGGKMIIPVGDVHSLQFLKLVTKKGNKTIEKDLLPVRFVPMVETAPKPKVR
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
67.6%
Unclassified
26.5%
Aphrophoridae
2.9%
Glossinidae
2.9%
Taxonomy
Archaea
1
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 5 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 22 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 23 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 32 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 33 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 34 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_021473 | 3300038395 | Bacteria | 4391 |
| 2 | Ga0466656_142987 | 3300042550 | Bacteria | 1491 |
| 3 | Ga0466701_005173 | 3300042598 | Bacteria | 1003 |
| 4 | Ga0466721_143465 | 3300042608 | Bacteria | 13673 |
| 5 | Ga0123356_10080831 | 3300010049 | Bacteria | 3074 |
| 6 | Ga0123356_10837985 | 3300010049 | Bacteria | 1091 |
| 7 | Ga0123356_10845574 | 3300010049 | Bacteria | 1086 |
| 8 | Ga0123353_10643789 | 3300010167 | Bacteria | 1502 |
| 9 | Ga0466710_224662 | 3300042613 | Bacteria | 26778 |
| 10 | Ga0466731_356403 | 3300042622 | Bacteria | 1421 |
| 11 | Ga0466731_398204 | 3300042622 | Bacteria | 7225 |
| 12 | Ga0466734_173525 | 3300042623 | Bacteria | 5490 |
| 13 | Ga0466702_406924 | 3300042635 | Bacteria | 1145 |
| 14 | Ga0466725_020295 | 3300042654 | Bacteria | 3292 |
| 15 | Ga0466695_016622 | 3300042595 | Bacteria | 1315 |
| 16 | Ga0123356_10079064 | 3300010049 | Bacteria | 3106 |
| 17 | Ga0123356_10722571 | 3300010049 | Bacteria | 1165 |
| 18 | Ga0123353_10018185 | 3300010167 | Bacteria | 10379 |
| 19 | Ga0123353_10328991 | 3300010167 | Bacteria | 2314 |
| 20 | Ga0123353_10699149 | 3300010167 | Bacteria | 1423 |
| 21 | JGI24702J35022_10007301 | 3300002462 | Bacteria | 6342 |
| 22 | JGI24702J35022_10018197 | 3300002462 | Bacteria | 3832 |
| 23 | Ga0466731_379732 | 3300042622 | Bacteria | 31002 |
| 24 | Ga0466725_076219 | 3300042654 | Bacteria | 3967 |
| 25 | Ga0415639_001599 | 3300038395 | Bacteria | 3294 |
| 26 | Ga0466695_310938 | 3300042595 | Bacteria | 4667 |
| 27 | Ga0466717_198600 | 3300042604 | Bacteria | 1107 |
| 28 | Ga0466721_091188 | 3300042608 | Bacteria | 1100 |
| 29 | Ga0123356_10148119 | 3300010049 | Bacteria | 2326 |
| 30 | Ga0123356_10268076 | 3300010049 | Bacteria | 1795 |
| 31 | Ga0123356_10651721 | 3300010049 | Bacteria | 1220 |
| 32 | Ga0123356_11819937 | 3300010049 | Bacteria | 757 |
| 33 | Ga0123356_11875692 | 3300010049 | Bacteria | 746 |
| 34 | Ga0123353_11442508 | 3300010167 | Bacteria | 881 |
| 35 | JGI24698J34947_10001965 | 3300002449 | Bacteria | 10965 |
| 36 | Ga0415639_079878 | 3300038395 | Bacteria | 1032 |
| 37 | Ga0466657_370180 | 3300042582 | Bacteria | 4736 |
| 38 | Ga0466694_188859 | 3300042594 | Bacteria | 5582 |
| 39 | Ga0466695_119336 | 3300042595 | Bacteria | 2031 |
| 40 | Ga0123355_10848227 | 3300009826 | Bacteria | 1006 |
| 41 | Ga0123356_10000943 | 3300010049 | Bacteria | 32172 |
| 42 | Ga0123356_10089472 | 3300010049 | Bacteria | 2929 |
| 43 | Ga0123356_10300903 | 3300010049 | Bacteria | 1709 |
| 44 | Ga0123356_10307418 | 3300010049 | Bacteria | 1693 |
| 45 | Ga0123356_10357915 | 3300010049 | Bacteria | 1585 |
| 46 | Ga0123353_10110760 | 3300010167 | Bacteria | 4423 |
| 47 | Ga0123353_10528748 | 3300010167 | Bacteria | 1708 |
| 48 | Ga0123353_10660545 | 3300010167 | Bacteria | 1477 |
| 49 | JGI24702J35022_10001722 | 3300002462 | Bacteria | 13558 |
| 50 | Ga0466712_222325 | 3300042614 | Bacteria | 22719 |
| 51 | Ga0466731_167414 | 3300042622 | Bacteria | 1125 |
| 52 | Ga0466725_080646 | 3300042654 | Bacteria | 5471 |
| 53 | Ga0466695_174812 | 3300042595 | Bacteria | 1227 |
| 54 | Ga0123356_10029953 | 3300010049 | Bacteria | 5095 |
| 55 | Ga0123356_10036960 | 3300010049 | Bacteria | 4558 |
| 56 | Ga0123356_10067201 | 3300010049 | Bacteria | 3358 |
| 57 | Ga0123356_10289670 | 3300010049 | Bacteria | 1737 |
| 58 | Ga0123356_10457359 | 3300010049 | Unclassified | 1425 |
| 59 | Ga0123356_10998551 | 3300010049 | Bacteria | 1007 |
| 60 | Ga0123353_10196077 | 3300010167 | Bacteria | 3183 |
| 61 | Ga0123353_10445238 | 3300010167 | Bacteria | 1909 |
| 62 | Ga0123353_11084267 | 3300010167 | Bacteria | 1065 |
| 63 | Ga0123354_10038253 | 3300010882 | Unclassified | 7451 |
| 64 | Ga0466697_164821 | 3300042611 | Bacteria | 1517 |
| 65 | Ga0123355_10127430 | 3300009826 | Bacteria | 3930 |
| 66 | Ga0123355_10261251 | 3300009826 | Bacteria | 2421 |
| 67 | Ga0123356_10010771 | 3300010049 | Bacteria | 8947 |
| 68 | Ga0123356_10035532 | 3300010049 | Bacteria | 4655 |
| 69 | Ga0123356_10037513 | 3300010049 | Bacteria | 4520 |
| 70 | Ga0123356_10091231 | 3300010049 | Bacteria | 2903 |
| 71 | Ga0123356_10136479 | 3300010049 | Bacteria | 2412 |
| 72 | Ga0123356_10242169 | 3300010049 | Bacteria | 1875 |
| 73 | Ga0123356_10289153 | 3300010049 | Bacteria | 1738 |
| 74 | Ga0123356_11293001 | 3300010049 | Bacteria | 893 |
| 75 | Ga0123353_10230403 | 3300010167 | Bacteria | 2889 |
| 76 | JGI24702J35022_10000069 | 3300002462 | Bacteria | 44707 |
| 77 | JGI24702J35022_10030465 | 3300002462 | Bacteria | 2895 |
| 78 | Ga0466718_164171 | 3300042617 | Bacteria | 1440 |
| 79 | Ga0466725_125057 | 3300042654 | Bacteria | 6799 |
| 80 | Ga0264413_127246 | 3300024493 | Unclassified | 5775 |
| 81 | Ga0466657_012444 | 3300042582 | Bacteria | 321104 |
| 82 | Ga0466700_412365 | 3300042600 | Unclassified | 1831 |
| 83 | Ga0123356_10373221 | 3300010049 | Bacteria | 1557 |
| 84 | Ga0123356_11169813 | 3300010049 | Bacteria | 936 |
| 85 | Ga0123353_10201973 | 3300010167 | Bacteria | 3126 |
| 86 | Ga0123353_10362954 | 3300010167 | Bacteria | 2175 |
| 87 | Ga0123353_10537617 | 3300010167 | Bacteria | 1690 |
| 88 | Ga0123353_10679964 | 3300010167 | Bacteria | 1450 |
| 89 | Ga0123354_10597556 | 3300010882 | Bacteria | 810 |
| 90 | JGI24702J35022_10081785 | 3300002462 | Bacteria | 1750 |
| 91 | Ga0466725_384599 | 3300042654 | Bacteria | 29241 |
| 92 | Ga0415639_008408 | 3300038395 | Bacteria | 3202 |
| 93 | Ga0415639_267557 | 3300038395 | Bacteria | 1120 |
| 94 | Ga0466657_214089 | 3300042582 | Bacteria | 4518 |
| 95 | Ga0466657_284204 | 3300042582 | Bacteria | 1513 |
| 96 | Ga0466695_283245 | 3300042595 | Archaea | 1107 |
| 97 | Ga0123355_10001344 | 3300009826 | Bacteria | 34139 |
| 98 | Ga0123355_10076444 | 3300009826 | Unclassified | 5355 |
| 99 | Ga0123356_10054756 | 3300010049 | Bacteria | 3715 |
| 100 | Ga0123356_10110736 | 3300010049 | Bacteria | 2652 |
| 101 | Ga0123356_10618197 | 3300010049 | Bacteria | 1249 |
| 102 | Ga0123356_10771369 | 3300010049 | Bacteria | 1132 |
| 103 | Ga0123353_11323229 | 3300010167 | Bacteria | 933 |
| 104 | JGI24702J35022_10094812 | 3300002462 | Bacteria | 1628 |
| 105 | JGI24702J35022_10141545 | 3300002462 | Bacteria | 1342 |
| 106 | Ga0466712_012143 | 3300042614 | Bacteria | 4944 |
| 107 | Ga0466731_102439 | 3300042622 | Bacteria | 2364 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01135 | PCMT | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) | 42 | 242 | 0.94 |
| PF13489 | Methyltransf_23 | Methyltransferase domain | 108 | 185 | 0.87 |
| PF13649 | Methyltransf_25 | Methyltransferase domain | 115 | 194 | 0.86 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 110 | 208 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.