Protein Family IF05074
Metagenome
Isolate
130
Members
46
Samples
125
Scaffolds
122.05
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_218867|Ga0466695_218867_71973_72413
- Length
- 146 aa
- Sequence
- MGGDELRATLARNIKLYRGLRDWSQADLSEKAGLSVVYLSDIERGNKWPYLDTLVKLAEAFEVEAFELLQPKNSQPPDETAAILVKYSEETLAILTASLETMKKHTFNSLISLRAQYLPKKPKKLAAYPSMRLENSMLAELREGYK
Sample Types
Isolate
3.9%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
30.2%
Unclassified
14.0%
Rhinotermitidae
7.0%
Termopsidae
4.7%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10364076 | 3300009784 | Bacteria | 1365 |
| 2 | Ga0123356_11396097 | 3300010049 | Bacteria | 861 |
| 3 | Ga0466707_046660 | 3300042601 | Bacteria | 1120 |
| 4 | Ga0466719_001970 | 3300042606 | Bacteria | 1025 |
| 5 | Ga0466712_028607 | 3300042614 | Bacteria | 4398 |
| 6 | Ga0466723_226264 | 3300042618 | Bacteria | 3162 |
| 7 | Ga0466728_420367 | 3300042620 | Bacteria | 1082 |
| 8 | FAAS_10767377 | 3300001880 | Bacteria | 559 |
| 9 | JGI24698J34947_10067571 | 3300002449 | Bacteria | 1734 |
| 10 | JGI24698J34947_10074053 | 3300002449 | Bacteria | 1623 |
| 11 | Ga0072941_1006027 | 3300005201 | Bacteria | 26639 |
| 12 | Ga0466703_005477 | 3300042636 | Bacteria | 1956 |
| 13 | Ga0466709_393358 | 3300042648 | Bacteria | 2792 |
| 14 | Ga0466727_237370 | 3300042655 | Bacteria | 1027 |
| 15 | Ga0466705_098088 | 3300042612 | Bacteria | 33204 |
| 16 | Ga0123356_12731845 | 3300010049 | Bacteria | 618 |
| 17 | Ga0466713_100916 | 3300042602 | Bacteria | 2327 |
| 18 | Ga0466720_042265 | 3300042607 | Bacteria | 3445 |
| 19 | Ga0466693_115289 | 3300042592 | Bacteria | 1214 |
| 20 | Ga0466693_322793 | 3300042592 | Bacteria | 2067 |
| 21 | Ga0466694_227673 | 3300042594 | Bacteria | 1469 |
| 22 | Ga0466696_363771 | 3300042596 | Bacteria | 1366 |
| 23 | Ga0466712_045986 | 3300042614 | Bacteria | 3204 |
| 24 | Ga0466726_456148 | 3300042619 | Unclassified | 2967 |
| 25 | JGI24698J34947_10164318 | 3300002449 | Bacteria | 906 |
| 26 | JGI24695J34938_10005428 | 3300002450 | Unclassified | 7949 |
| 27 | JGI24695J34938_10009025 | 3300002450 | Bacteria | 5595 |
| 28 | Ga0072941_1004431 | 3300005201 | Bacteria | 21264 |
| 29 | Ga0072941_1009578 | 3300005201 | Bacteria | 6397 |
| 30 | Ga0072941_1265054 | 3300005201 | Bacteria | 988 |
| 31 | Ga0466731_189552 | 3300042622 | Bacteria | 1117 |
| 32 | Ga0466731_285614 | 3300042622 | Bacteria | 1103 |
| 33 | Ga0123356_10449741 | 3300010049 | Bacteria | 1436 |
| 34 | Ga0123353_10129783 | 3300010167 | Bacteria | 4046 |
| 35 | Ga0466719_272714 | 3300042606 | Bacteria | 1814 |
| 36 | Ga0264413_144173 | 3300024493 | Bacteria | 2226 |
| 37 | Ga0456237_0053433 | 3300041968 | Bacteria | 525 |
| 38 | Ga0466690_160553 | 3300042590 | Bacteria | 1088 |
| 39 | Ga0466693_151220 | 3300042592 | Bacteria | 1138 |
| 40 | Ga0466695_218867 | 3300042595 | Bacteria | 114312 |
| 41 | Ga0466699_143034 | 3300042597 | Bacteria | 2841 |
| 42 | Ga0466718_055948 | 3300042617 | Bacteria | 4253 |
| 43 | Ga0466718_083281 | 3300042617 | Bacteria | 2365 |
| 44 | Ga0466718_126025 | 3300042617 | Bacteria | 3872 |
| 45 | Ga0072941_1005181 | 3300005201 | Bacteria | 14850 |
| 46 | Ga0072941_1787956 | 3300005201 | Bacteria | 589 |
| 47 | Ga0123356_13622223 | 3300010049 | Bacteria | 535 |
| 48 | Ga0456237_0000037 | 3300041968 | Bacteria | 19775 |
| 49 | Ga0466690_099805 | 3300042590 | Bacteria | 1806 |
| 50 | Ga0466712_180690 | 3300042614 | Bacteria | 7003 |
| 51 | Ga0466718_166019 | 3300042617 | Bacteria | 1312 |
| 52 | Ga0072941_1001144 | 3300005201 | Bacteria | 20710 |
| 53 | Ga0072941_1055559 | 3300005201 | Bacteria | 906 |
| 54 | Ga0466703_083884 | 3300042636 | Bacteria | 7053 |
| 55 | Ga0466708_126106 | 3300042652 | Bacteria | 1752 |
| 56 | Ga0466705_221211 | 3300042612 | Bacteria | 8207 |
| 57 | Ga0466732_021447 | 3300042656 | Bacteria | 27364 |
| 58 | Ga0466732_244611 | 3300042656 | Bacteria | 3341 |
| 59 | Ga0123355_10099048 | 3300009826 | Bacteria | 4595 |
| 60 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 61 | Ga0466722_079947 | 3300042609 | Bacteria | 16203 |
| 62 | Ga0415639_050379 | 3300038395 | Bacteria | 11525 |
| 63 | Ga0466690_200237 | 3300042590 | Bacteria | 8390 |
| 64 | Ga0466694_171480 | 3300042594 | Bacteria | 1034 |
| 65 | Ga0466699_158477 | 3300042597 | Bacteria | 13308 |
| 66 | Ga0466712_121797 | 3300042614 | Bacteria | 1446 |
| 67 | Ga0466715_054648 | 3300042616 | Bacteria | 12031 |
| 68 | AustNasuHG_c1018032 | 3300000089 | Bacteria | 2335 |
| 69 | JGI24695J34938_10121594 | 3300002450 | Bacteria | 1063 |
| 70 | JGI24695J34938_10205084 | 3300002450 | Bacteria | 823 |
| 71 | Ga0466731_095265 | 3300042622 | Unclassified | 7081 |
| 72 | Ga0466705_329804 | 3300042612 | Bacteria | 1602 |
| 73 | Ga0456237_0045709 | 3300041968 | Bacteria | 574 |
| 74 | Ga0466694_054063 | 3300042594 | Bacteria | 1986 |
| 75 | Ga0466699_050948 | 3300042597 | Bacteria | 1535 |
| 76 | Ga0466715_195670 | 3300042616 | Bacteria | 1860 |
| 77 | Ga0466715_410081 | 3300042616 | Bacteria | 2864 |
| 78 | Ga0466723_015291 | 3300042618 | Bacteria | 1632 |
| 79 | Ga0466726_019971 | 3300042619 | Bacteria | 2777 |
| 80 | Ga0466726_320898 | 3300042619 | Bacteria | 1362 |
| 81 | AustNasuHG_c1021170 | 3300000089 | Bacteria | 2109 |
| 82 | FAAS_10847289 | 3300001880 | Unclassified | 507 |
| 83 | JGI24698J34947_10004473 | 3300002449 | Bacteria | 7612 |
| 84 | JGI24698J34947_10004571 | 3300002449 | Bacteria | 7539 |
| 85 | JGI24698J34947_10066729 | 3300002449 | Bacteria | 1750 |
| 86 | JGI24695J34938_10155571 | 3300002450 | Bacteria | 938 |
| 87 | Ga0068305_10916555 | 3300005083 | Bacteria | 1048 |
| 88 | Ga0466704_180407 | 3300042643 | Bacteria | 12754 |
| 89 | Ga0123356_12597806 | 3300010049 | Bacteria | 634 |
| 90 | Ga0123356_13634528 | 3300010049 | Bacteria | 534 |
| 91 | Ga0466716_056927 | 3300042605 | Bacteria | 1838 |
| 92 | Ga0466716_262746 | 3300042605 | Bacteria | 6715 |
| 93 | Ga0466720_169413 | 3300042607 | Unclassified | 2310 |
| 94 | Ga0466698_076147 | 3300042610 | Bacteria | 9053 |
| 95 | Ga0466712_047216 | 3300042614 | Unclassified | 1565 |
| 96 | Ga0466712_073328 | 3300042614 | Bacteria | 3361 |
| 97 | Ga0466718_067570 | 3300042617 | Bacteria | 1015 |
| 98 | FAAS_10749497 | 3300001880 | Bacteria | 510 |
| 99 | JGI24698J34947_10024442 | 3300002449 | Unclassified | 3226 |
| 100 | JGI24698J34947_10024665 | 3300002449 | Bacteria | 3210 |
| 101 | JGI24695J34938_10001247 | 3300002450 | Bacteria | 22361 |
| 102 | JGI24695J34938_10045296 | 3300002450 | Unclassified | 1952 |
| 103 | JGI24695J34938_10076649 | 3300002450 | Bacteria | 1388 |
| 104 | JGI24695J34938_10155918 | 3300002450 | Bacteria | 937 |
| 105 | Ga0072940_1165661 | 3300005200 | Bacteria | 939 |
| 106 | Ga0072940_1320769 | 3300005200 | Bacteria | 1351 |
| 107 | Ga0072941_1098844 | 3300005201 | Bacteria | 6719 |
| 108 | Ga0123356_10002502 | 3300010049 | Bacteria | 19622 |
| 109 | Ga0123356_10580231 | 3300010049 | Bacteria | 1284 |
| 110 | Ga0456237_0000886 | 3300041968 | Unclassified | 4700 |
| 111 | Ga0466693_174461 | 3300042592 | Bacteria | 16735 |
| 112 | Ga0466693_220147 | 3300042592 | Bacteria | 2233 |
| 113 | Ga0466691_088930 | 3300042593 | Bacteria | 7717 |
| 114 | Ga0466694_084064 | 3300042594 | Bacteria | 12037 |
| 115 | Ga0466718_068881 | 3300042617 | Bacteria | 2147 |
| 116 | Ga0466726_159230 | 3300042619 | Bacteria | 12199 |
| 117 | Ga0466726_251632 | 3300042619 | Bacteria | 3274 |
| 118 | AustNasuHG_c1006122 | 3300000089 | Bacteria | 4299 |
| 119 | JGI24698J34947_10020665 | 3300002449 | Bacteria | 3544 |
| 120 | JGI24695J34938_10009167 | 3300002450 | Bacteria | 5527 |
| 121 | JGI24695J34938_10438777 | 3300002450 | Unclassified | 588 |
| 122 | JGI24695J34938_10484883 | 3300002450 | Bacteria | 563 |
| 123 | Ga0072940_1017466 | 3300005200 | Bacteria | 1333 |
| 124 | Ga0072941_1069167 | 3300005201 | Bacteria | 3099 |
| 125 | Ga0466729_256109 | 3300042621 | Bacteria | 3220 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.