Protein Family IF05054
Metagenome
Isolate
189
Members
50
Samples
175
Scaffolds
312.67
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_382585|Ga0466694_382585_913_1785
- Length
- 290 aa
- Sequence
- MSVFGENENIEEDDDISALEDEPKQRNVITGIDAGIESIAPDAPIYRLRLLYSHETFLAIFREENLLPDTMVIVPTRYGNDLAQVISSVRGILPQVSETAWIVRTANEEDLRKSHNNSRLEKEAFNICRKKIENHKLEMKLVLVHYLLEEPKILFFFTADNRVDFRELVKDLVSVFKTRIELRQIGVRDEARVVGGLGVCGRGYCCHCVSDKLKPVSIKMAKEQKVSINSIKISGPCGRLLCCLFYEYGFYCKQHCALPQEETQINYNNDSCNVTEVNQITGQIKLSIDE
Sample Types
Isolate
7.4%
Metagenome
92.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.7%
Unclassified
29.2%
Kalotermitidae
18.8%
Termopsidae
6.2%
Rhinotermitidae
4.2%
Taxonomy
Archaea
1
Bacteria
172
Eukaryota
0
Viruses
1
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 13 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 31 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 32 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 35 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 36 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 37 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 38 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 45 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 46 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_100675 | 3300024493 | Bacteria | 52863 |
| 2 | Ga0466690_252570 | 3300042590 | Bacteria | 7252 |
| 3 | Ga0466694_060905 | 3300042594 | Bacteria | 1794 |
| 4 | Ga0466709_112720 | 3300042648 | Bacteria | 7590 |
| 5 | Ga0466700_017887 | 3300042600 | Bacteria | 21698 |
| 6 | Ga0466720_020438 | 3300042607 | Bacteria | 42880 |
| 7 | Ga0466721_020736 | 3300042608 | Bacteria | 2044 |
| 8 | AustNasuHG_c1000135 | 3300000089 | Bacteria | 22970 |
| 9 | AustNasuHG_c1001887 | 3300000089 | Bacteria | 7553 |
| 10 | JGI24698J34947_10011480 | 3300002449 | Unclassified | 4864 |
| 11 | JGI24698J34947_10030389 | 3300002449 | Bacteria | 2849 |
| 12 | JGI24695J34938_10000252 | 3300002450 | Bacteria | 51869 |
| 13 | JGI24695J34938_10006242 | 3300002450 | Bacteria | 7228 |
| 14 | JGI24695J34938_10018956 | 3300002450 | Bacteria | 3423 |
| 15 | Ga0072941_1002931 | 3300005201 | Bacteria | 16731 |
| 16 | Ga0072941_1046809 | 3300005201 | Bacteria | 9005 |
| 17 | Ga0074263_101816 | 3300005485 | Bacteria | 2861 |
| 18 | Ga0466712_247150 | 3300042614 | Bacteria | 17667 |
| 19 | Ga0466718_003118 | 3300042617 | Bacteria | 24685 |
| 20 | Ga0466723_291340 | 3300042618 | Bacteria | 16931 |
| 21 | Ga0466726_329867 | 3300042619 | Bacteria | 2210 |
| 22 | Ga0123356_10066112 | 3300010049 | Bacteria | 3384 |
| 23 | Ga0466705_113672 | 3300042612 | Bacteria | 11968 |
| 24 | Ga0466732_054799 | 3300042656 | Bacteria | 38151 |
| 25 | Ga0466732_321963 | 3300042656 | Bacteria | 8960 |
| 26 | Ga0466733_041831 | 3300042659 | Bacteria | 4764 |
| 27 | Ga0264413_100942 | 3300024493 | Bacteria | 33361 |
| 28 | Ga0415639_037690 | 3300038395 | Bacteria | 8764 |
| 29 | Ga0415639_047264 | 3300038395 | Bacteria | 7528 |
| 30 | Ga0466694_014638 | 3300042594 | Bacteria | 12224 |
| 31 | Ga0466694_089239 | 3300042594 | Bacteria | 21293 |
| 32 | Ga0466731_012920 | 3300042622 | Bacteria | 154202 |
| 33 | Ga0466702_160761 | 3300042635 | Bacteria | 6932 |
| 34 | Ga0466722_021556 | 3300042609 | Bacteria | 3698 |
| 35 | JGI24698J34947_10022828 | 3300002449 | Bacteria | 3350 |
| 36 | JGI24698J34947_10037587 | 3300002449 | Bacteria | 2514 |
| 37 | JGI24698J34947_10052350 | 3300002449 | Unclassified | 2049 |
| 38 | JGI24695J34938_10001176 | 3300002450 | Bacteria | 23259 |
| 39 | Ga0466712_117775 | 3300042614 | Bacteria | 9897 |
| 40 | Ga0466712_174536 | 3300042614 | Bacteria | 7039 |
| 41 | Ga0123356_10062713 | 3300010049 | Bacteria | 3473 |
| 42 | Ga0466732_271539 | 3300042656 | Bacteria | 18319 |
| 43 | Ga0264413_101464 | 3300024493 | Unclassified | 2171 |
| 44 | Ga0466692_139016 | 3300042591 | Bacteria | 4659 |
| 45 | Ga0466694_382585 | 3300042594 | Bacteria | 1939 |
| 46 | Ga0466735_025071 | 3300042624 | Bacteria | 13306 |
| 47 | Ga0466720_040059 | 3300042607 | Bacteria | 10170 |
| 48 | Ga0466722_085689 | 3300042609 | Bacteria | 3851 |
| 49 | Ga0466722_127947 | 3300042609 | Bacteria | 11085 |
| 50 | Ga0466722_262362 | 3300042609 | Bacteria | 8817 |
| 51 | AustNasuHG_c1001336 | 3300000089 | Bacteria | 8848 |
| 52 | JGI24698J34947_10023151 | 3300002449 | Unclassified | 3323 |
| 53 | JGI24698J34947_10048122 | 3300002449 | Unclassified | 2161 |
| 54 | JGI24695J34938_10001829 | 3300002450 | Bacteria | 17383 |
| 55 | JGI24695J34938_10004054 | 3300002450 | Bacteria | 9814 |
| 56 | JGI24695J34938_10014683 | 3300002450 | Bacteria | 4048 |
| 57 | Ga0072941_1046837 | 3300005201 | Bacteria | 9645 |
| 58 | Ga0074263_103224 | 3300005485 | Bacteria | 1402 |
| 59 | Ga0466712_030533 | 3300042614 | Bacteria | 21189 |
| 60 | Ga0466712_166630 | 3300042614 | Bacteria | 4858 |
| 61 | Ga0466715_003901 | 3300042616 | Bacteria | 26867 |
| 62 | Ga0466718_062858 | 3300042617 | Bacteria | 3382 |
| 63 | Ga0123356_10000044 | 3300010049 | Bacteria | 132964 |
| 64 | Ga0123356_10005764 | 3300010049 | Bacteria | 12570 |
| 65 | Ga0123356_10124098 | 3300010049 | Bacteria | 2518 |
| 66 | Ga0123356_10144295 | 3300010049 | Bacteria | 2353 |
| 67 | Ga0466694_024974 | 3300042594 | Bacteria | 29638 |
| 68 | Ga0466694_073495 | 3300042594 | Bacteria | 22298 |
| 69 | Ga0466703_413621 | 3300042636 | Bacteria | 8368 |
| 70 | Ga0466727_235927 | 3300042655 | Unclassified | 1305 |
| 71 | Ga0466720_031963 | 3300042607 | Bacteria | 3940 |
| 72 | JGI24698J34947_10005610 | 3300002449 | Unclassified | 6880 |
| 73 | JGI24695J34938_10005893 | 3300002450 | Bacteria | 7518 |
| 74 | Ga0072941_1008420 | 3300005201 | Bacteria | 21514 |
| 75 | Ga0466712_051848 | 3300042614 | Bacteria | 3256 |
| 76 | Ga0466712_056403 | 3300042614 | Bacteria | 1822 |
| 77 | Ga0466712_088678 | 3300042614 | Bacteria | 9635 |
| 78 | Ga0466712_149080 | 3300042614 | Bacteria | 2758 |
| 79 | Ga0123356_10028538 | 3300010049 | Archaea | 5229 |
| 80 | Ga0466732_100832 | 3300042656 | Bacteria | 1259 |
| 81 | Ga0415639_090355 | 3300038395 | Bacteria | 3573 |
| 82 | Ga0466692_082197 | 3300042591 | Bacteria | 8006 |
| 83 | Ga0466694_007780 | 3300042594 | Bacteria | 15848 |
| 84 | Ga0466696_305197 | 3300042596 | Bacteria | 1459 |
| 85 | Ga0466731_061986 | 3300042622 | Bacteria | 6258 |
| 86 | Ga0466731_171167 | 3300042622 | Bacteria | 1335 |
| 87 | Ga0466727_015555 | 3300042655 | Bacteria | 1402 |
| 88 | Ga0466720_094836 | 3300042607 | Bacteria | 9906 |
| 89 | Ga0466720_174499 | 3300042607 | Bacteria | 5212 |
| 90 | Ga0466721_258272 | 3300042608 | Bacteria | 28969 |
| 91 | Ga0466722_243899 | 3300042609 | Bacteria | 8865 |
| 92 | JGI24698J34947_10006981 | 3300002449 | Bacteria | 6207 |
| 93 | JGI24695J34938_10000266 | 3300002450 | Bacteria | 50844 |
| 94 | JGI24695J34938_10000810 | 3300002450 | Bacteria | 29046 |
| 95 | JGI24695J34938_10002632 | 3300002450 | Bacteria | 13443 |
| 96 | JGI24695J34938_10013626 | 3300002450 | Unclassified | 4259 |
| 97 | Ga0072941_1002929 | 3300005201 | Bacteria | 20203 |
| 98 | Ga0072941_1028924 | 3300005201 | Bacteria | 22610 |
| 99 | Ga0466715_268535 | 3300042616 | Bacteria | 15651 |
| 100 | Ga0466715_278161 | 3300042616 | Bacteria | 20583 |
| 101 | Ga0466718_031913 | 3300042617 | Bacteria | 14989 |
| 102 | Ga0466718_082632 | 3300042617 | Bacteria | 2155 |
| 103 | Ga0466718_083674 | 3300042617 | Bacteria | 23117 |
| 104 | Ga0466718_169252 | 3300042617 | Unclassified | 4043 |
| 105 | Ga0466723_267557 | 3300042618 | Bacteria | 2846 |
| 106 | Ga0123355_10003925 | 3300009826 | Bacteria | 21517 |
| 107 | Ga0123356_10050873 | 3300010049 | Viruses | 3854 |
| 108 | Ga0123353_10690804 | 3300010167 | Bacteria | 1435 |
| 109 | Ga0264413_104978 | 3300024493 | Unclassified | 4340 |
| 110 | Ga0466702_032352 | 3300042635 | Bacteria | 3570 |
| 111 | Ga0466702_233542 | 3300042635 | Bacteria | 5681 |
| 112 | Ga0466702_286179 | 3300042635 | Bacteria | 6744 |
| 113 | Ga0466704_428013 | 3300042643 | Bacteria | 23996 |
| 114 | Ga0466720_033362 | 3300042607 | Bacteria | 10471 |
| 115 | JGI24698J34947_10061470 | 3300002449 | Bacteria | 1848 |
| 116 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 117 | JGI24695J34938_10001897 | 3300002450 | Bacteria | 16928 |
| 118 | JGI24695J34938_10002791 | 3300002450 | Bacteria | 12805 |
| 119 | JGI24695J34938_10036741 | 3300002450 | Bacteria | 2231 |
| 120 | JGI24695J34938_10044608 | 3300002450 | Bacteria | 1971 |
| 121 | Ga0466712_221614 | 3300042614 | Bacteria | 3445 |
| 122 | Ga0466718_075255 | 3300042617 | Bacteria | 21483 |
| 123 | Ga0466726_308592 | 3300042619 | Bacteria | 1480 |
| 124 | Ga0123356_10003512 | 3300010049 | Bacteria | 16402 |
| 125 | Ga0123356_10028774 | 3300010049 | Bacteria | 5207 |
| 126 | Ga0264413_101463 | 3300024493 | Bacteria | 9391 |
| 127 | Ga0415639_025750 | 3300038395 | Bacteria | 5284 |
| 128 | Ga0466693_283771 | 3300042592 | Bacteria | 9741 |
| 129 | Ga0466694_026216 | 3300042594 | Bacteria | 44731 |
| 130 | Ga0466699_345003 | 3300042597 | Bacteria | 2264 |
| 131 | Ga0466731_103759 | 3300042622 | Bacteria | 5142 |
| 132 | Ga0466731_329006 | 3300042622 | Bacteria | 3142 |
| 133 | Ga0466702_349455 | 3300042635 | Bacteria | 1623 |
| 134 | Ga0466703_059458 | 3300042636 | Bacteria | 2930 |
| 135 | Ga0466704_393458 | 3300042643 | Bacteria | 46073 |
| 136 | Ga0466709_227983 | 3300042648 | Bacteria | 10490 |
| 137 | Ga0466727_051225 | 3300042655 | Bacteria | 3666 |
| 138 | Ga0466716_486274 | 3300042605 | Unclassified | 2549 |
| 139 | JGI24698J34947_10011415 | 3300002449 | Unclassified | 4878 |
| 140 | JGI24698J34947_10015614 | 3300002449 | Bacteria | 4133 |
| 141 | JGI24698J34947_10048129 | 3300002449 | Bacteria | 2161 |
| 142 | JGI24695J34938_10000048 | 3300002450 | Bacteria | 91577 |
| 143 | JGI24695J34938_10001343 | 3300002450 | Bacteria | 21253 |
| 144 | Ga0074263_112333 | 3300005485 | Bacteria | 5679 |
| 145 | Ga0466712_000935 | 3300042614 | Bacteria | 58223 |
| 146 | Ga0466712_098542 | 3300042614 | Bacteria | 6984 |
| 147 | Ga0466712_107891 | 3300042614 | Bacteria | 6994 |
| 148 | Ga0466718_010984 | 3300042617 | Bacteria | 4811 |
| 149 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 150 | Ga0415639_072444 | 3300038395 | Bacteria | 3887 |
| 151 | Ga0466690_239544 | 3300042590 | Bacteria | 3254 |
| 152 | Ga0466692_004401 | 3300042591 | Bacteria | 5895 |
| 153 | Ga0466694_029903 | 3300042594 | Bacteria | 4844 |
| 154 | Ga0466702_050770 | 3300042635 | Bacteria | 2706 |
| 155 | Ga0466702_333415 | 3300042635 | Bacteria | 2363 |
| 156 | Ga0466727_319938 | 3300042655 | Bacteria | 1271 |
| 157 | Ga0466722_196199 | 3300042609 | Bacteria | 2146 |
| 158 | JGI24698J34947_10000251 | 3300002449 | Bacteria | 22586 |
| 159 | JGI24698J34947_10043005 | 3300002449 | Bacteria | 2318 |
| 160 | JGI24698J34947_10057626 | 3300002449 | Unclassified | 1926 |
| 161 | JGI24695J34938_10000306 | 3300002450 | Bacteria | 48176 |
| 162 | JGI24695J34938_10001888 | 3300002450 | Bacteria | 16972 |
| 163 | JGI24695J34938_10005607 | 3300002450 | Bacteria | 7777 |
| 164 | JGI24695J34938_10006838 | 3300002450 | Bacteria | 6773 |
| 165 | JGI24695J34938_10009530 | 3300002450 | Bacteria | 5393 |
| 166 | JGI24695J34938_10010168 | 3300002450 | Bacteria | 5181 |
| 167 | Ga0072941_1001531 | 3300005201 | Bacteria | 5035 |
| 168 | Ga0072941_1022529 | 3300005201 | Bacteria | 5606 |
| 169 | Ga0074263_109876 | 3300005485 | Unclassified | 3389 |
| 170 | Ga0466712_109439 | 3300042614 | Bacteria | 27739 |
| 171 | Ga0466718_024218 | 3300042617 | Unclassified | 10148 |
| 172 | Ga0466718_094646 | 3300042617 | Bacteria | 6431 |
| 173 | Ga0466726_404437 | 3300042619 | Bacteria | 1789 |
| 174 | Ga0466726_418603 | 3300042619 | Bacteria | 5703 |
| 175 | Ga0123353_10079189 | 3300010167 | Bacteria | 5282 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04468 | PSP1 | PSP1 C-terminal conserved region | 102 | 185 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.