Protein Family IF05049

Metagenome Isolate
137 Members
47 Samples
119 Scaffolds
406.72 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_362578|Ga0466694_362578_275_1597
Length
440 aa
Sequence
MPTAFTLQRPLLNRHKNMLNFFHLCNIIINANMTIIQGVWNMNVLVINAGSSSLKYQMFEMETETIIAKGICDRIGIDGHLKHSPVSNGKPVFDSDIELPTHSEAIAAVIEKLTSAEYGVIGNLSEIDAVGHRIVHGGRKFSESVLVDDDVVAALADCILLAPLHVPANVMGVKACRAAMPDVPQVVVFDTAFHHTMPEYAYVYPIPYKYYEKNDIRRYGFHGTSHRYVSAKAIELLGREPHGTGIITCHLGNGASLAAIKDGKCIDTSMGVTPLEGVPMGTRCGNIDPTLIGIISEIEGGLSLSETMDILNKESGVLGVSGVSSDFRDVESAILAGNKQAKLALDIFSYQVAKVIGSYIAVLGGTDAIVFTAGVGENSPYARKIICEYLGGAGVCIDEKKNDIKGKQAEITGDGSKLRVFVIPTDEELVIARDTRAIIM

📊 Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.4%
Termitidae 27.7%
Kalotermitidae 14.9%
Termopsidae 6.4%
Rhinotermitidae 4.3%
Formicidae 2.1%
Cicadellidae 2.1%
Passalidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
2 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
3 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
9 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
10 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
11 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
17 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
24 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
25 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
29 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
30 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
34 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
35 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
36 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
42 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
43 2718218463 Candidatus Phytoplasma M3 Isolate Cicadellidae
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_140535 3300042643 Bacteria 2322
2 Ga0466714_112582 3300042603 Bacteria 84178
3 Ga0123355_10000151 3300009826 Bacteria 83578
4 Ga0123356_10000194 3300010049 Bacteria 69995
5 Ga0123356_10007512 3300010049 Bacteria 10868
6 Ga0123356_10013042 3300010049 Bacteria 8039
7 Ga0123356_10014533 3300010049 Bacteria 7566
8 Ga0123356_10015249 3300010049 Bacteria 7369
9 Ga0123356_10017165 3300010049 Bacteria 6888
10 Ga0123356_10021277 3300010049 Bacteria 6124
11 Ga0123356_10244665 3300010049 Bacteria 1867
12 Ga0123353_10053609 3300010167 Unclassified 6446
13 JGI24702J35022_10024381 3300002462 Bacteria 3269
14 Ga0466692_105524 3300042591 Bacteria 3205
15 Ga0466719_377041 3300042606 Bacteria 1643
16 Ga0466719_501000 3300042606 Bacteria 3582
17 Ga0466721_126246 3300042608 Bacteria 14450
18 Ga0123355_10015461 3300009826 Bacteria 11992
19 Ga0123356_10004068 3300010049 Bacteria 15188
20 Ga0123353_10054605 3300010167 Bacteria 6388
21 Ga0123353_10497326 3300010167 Bacteria 1778
22 Ga0123353_10748660 3300010167 Unclassified 1360
23 IMNBL1DRAFT_c0000117 3300000062 Bacteria 71901
24 Ga0102734_1000076 3300007129 Bacteria 30554
25 Ga0466705_052411 3300042612 Bacteria 10091
26 Ga0466727_347742 3300042655 Bacteria 2088
27 Ga0123355_10048345 3300009826 Bacteria 6916
28 Ga0123356_10000251 3300010049 Bacteria 61694
29 Ga0123356_10037448 3300010049 Bacteria 4526
30 Ga0123356_10046267 3300010049 Bacteria 4048
31 Ga0123356_10185296 3300010049 Bacteria 2107
32 Ga0123356_10518430 3300010049 Bacteria 1350
33 Ga0123353_10057834 3300010167 Bacteria 6211
34 Ga0123353_10104924 3300010167 Bacteria 4554
35 Ga0123353_10315973 3300010167 Bacteria 2373
36 Ga0123353_10354947 3300010167 Bacteria 2207
37 Ga0466726_265968 3300042619 Bacteria 49048
38 Ga0415639_062798 3300038395 Bacteria 2191
39 Ga0466705_128064 3300042612 Bacteria 302359
40 Ga0466735_186117 3300042624 Bacteria 1664
41 Ga0123355_10023636 3300009826 Bacteria 9872
42 Ga0123356_10002143 3300010049 Bacteria 21272
43 Ga0123356_10102055 3300010049 Bacteria 2753
44 Ga0123356_10321524 3300010049 Bacteria 1660
45 Ga0123353_10030953 3300010167 Bacteria 8279
46 Ga0123353_10065910 3300010167 Bacteria 5813
47 Ga0123353_10071226 3300010167 Bacteria 5586
48 Ga0123353_10072046 3300010167 Bacteria 5553
49 Ga0123353_10155056 3300010167 Bacteria 3653
50 Ga0123353_10185583 3300010167 Bacteria 3289
51 Ga0123353_10187085 3300010167 Bacteria 3273
52 JGI24695J34938_10000980 3300002450 Bacteria 25966
53 Ga0466694_362578 3300042594 Bacteria 2682
54 Ga0466735_074267 3300042624 Bacteria 99444
55 Ga0466727_155334 3300042655 Bacteria 8203
56 Ga0466727_330224 3300042655 Bacteria 3118
57 Ga0123356_10002106 3300010049 Bacteria 21458
58 Ga0123356_10017106 3300010049 Bacteria 6901
59 Ga0123353_10000058 3300010167 Bacteria 125313
60 Ga0123353_10314502 3300010167 Bacteria 2381
61 Ga0466715_015935 3300042616 Bacteria 27830
62 Ga0466723_111816 3300042618 Bacteria 23829
63 Ga0466726_493032 3300042619 Bacteria 8097
64 JGI24695J34938_10003781 3300002450 Bacteria 10312
65 Ga0415639_003313 3300038395 Bacteria 9183
66 Ga0466696_146790 3300042596 Bacteria 19807
67 Ga0466705_061353 3300042612 Bacteria 3458
68 Ga0466735_097927 3300042624 Bacteria 15902
69 Ga0466714_040886 3300042603 Bacteria 2352
70 Ga0123356_10005324 3300010049 Bacteria 13122
71 Ga0123356_10019867 3300010049 Bacteria 6364
72 Ga0123356_10023414 3300010049 Bacteria 5812
73 Ga0123356_10141012 3300010049 Bacteria 2377
74 Ga0123356_10278801 3300010049 Bacteria 1766
75 Ga0123353_10024564 3300010167 Bacteria 9155
76 Ga0123353_10217112 3300010167 Bacteria 2994
77 Ga0123353_10224384 3300010167 Bacteria 2935
78 Ga0123353_10559333 3300010167 Bacteria 1647
79 JGI24705J35276_12237642 3300002504 Bacteria 12282
80 Ga0466727_125836 3300042655 Bacteria 2128
81 Ga0466707_077425 3300042601 Bacteria 32634
82 Ga0466707_205832 3300042601 Bacteria 16244
83 Ga0466714_043674 3300042603 Bacteria 35783
84 Ga0466719_314778 3300042606 Bacteria 6642
85 Ga0466721_393620 3300042608 Bacteria 48776
86 Ga0466722_023923 3300042609 Bacteria 10762
87 Ga0466722_199686 3300042609 Bacteria 4314
88 Ga0123355_10001324 3300009826 Bacteria 34505
89 Ga0123356_10000095 3300010049 Bacteria 92617
90 Ga0123353_10006009 3300010167 Bacteria 16076
91 Ga0123353_10066906 3300010167 Bacteria 5769
92 Ga0123353_10202736 3300010167 Bacteria 3119
93 Ga0123353_10242104 3300010167 Bacteria 2802
94 Ga0123353_10453446 3300010167 Bacteria 1887
95 JGI24695J34938_10000231 3300002450 Bacteria 53005
96 Ga0415639_027131 3300038395 Bacteria 33706
97 Ga0466696_361360 3300042596 Bacteria 5232
98 Ga0466702_002145 3300042635 Bacteria 1615
99 Ga0123357_10066184 3300009784 Bacteria 4821
100 Ga0123355_10003164 3300009826 Bacteria 23495
101 Ga0123355_10003620 3300009826 Bacteria 22255
102 Ga0123355_10129743 3300009826 Bacteria 3886
103 Ga0123355_10508540 3300009826 Bacteria 1481
104 Ga0123356_10000097 3300010049 Bacteria 92344
105 Ga0123356_10000459 3300010049 Bacteria 45589
106 Ga0123356_10000804 3300010049 Bacteria 34884
107 Ga0123356_10012429 3300010049 Bacteria 8262
108 Ga0123356_10060842 3300010049 Bacteria 3525
109 Ga0123356_10132408 3300010049 Bacteria 2445
110 Ga0123353_10000568 3300010167 Bacteria 45462
111 Ga0123353_10014454 3300010167 Bacteria 11381
112 Ga0123353_10020206 3300010167 Bacteria 9936
113 Ga0123353_10086250 3300010167 Bacteria 5056
114 Ga0123353_10258190 3300010167 Bacteria 2694
115 Ga0123354_10045617 3300010882 Bacteria 6706
116 Ga0466705_391717 3300042612 Bacteria 39966
117 Ga0466723_096155 3300042618 Bacteria 16929
118 Ga0466728_054655 3300042620 Bacteria 5558
119 Ga0068305_10011964 3300005083 Bacteria 124405

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00871 Acetate_kinase Acetokinase family 44 433 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.