Protein Family IF05042

Metagenome Isolate
153 Members
64 Samples
130 Scaffolds
247.56 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_319537|Ga0466694_319537_1100_1981
Length
293 aa
Sequence
MCERKNHIPCPISWAKRRCFILKGMHSNISEKSCFLYYRCLRIGVFLMIDLKGKTAIVTGATRGIGLEISKVLAENGANVAIIDIQLGDGSSIKEVEALGVTCKGYACDVSNPEAVEETFKQIVTEFGKVDILVNNAGITRDNLIIRMKQEDFDAVLNVNLRSAFICTKAISSHLMRNRSGRIINMASINGIRCQAGQANYAASKAGIIGLTKSNAMEFAARGVTVNAVAPGFIKTAMTDKLAPETIAKYKEAIPLKDLGSPRDVANVVAFLASNEAAYVTGQVLGVDGGLGA

📊 Sample Types

Isolate 15.0%
Metagenome 85.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.2%
Unclassified 27.4%
Kalotermitidae 16.1%
Rhinotermitidae 3.2%
Formicidae 3.2%
Termopsidae 3.2%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 33

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
2 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
3 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
8 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
9 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
10 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
16 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
17 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
18 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
19 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
20 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 2900368070 Nocardia aurantia RB56 Isolate Termitidae
35 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
36 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
37 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
38 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
44 2820714932 Unclassified Fibrobacteres Nc150P4bin10 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
53 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
54 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
55 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
56 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
57 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_170426 3300042656 Bacteria 3066
2 Ga0466705_485285 3300042612 Bacteria 9969
3 Ga0466712_165115 3300042614 Bacteria 10115
4 Ga0466712_189080 3300042614 Unclassified 13796
5 Ga0466718_095232 3300042617 Unclassified 15320
6 Ga0466706_062060 3300042599 Bacteria 24698
7 Ga0466705_175659 3300042612 Bacteria 2329
8 Ga0466702_012684 3300042635 Unclassified 14532
9 AustNasuHG_c1010464 3300000089 Unclassified 3232
10 AustNasuHG_c1016636 3300000089 Unclassified 2455
11 JGI24698J34947_10000181 3300002449 Bacteria 24967
12 JGI24695J34938_10000001 3300002450 Bacteria 290906
13 Ga0466694_025955 3300042594 Unclassified 1800
14 Ga0466694_207296 3300042594 Bacteria 10315
15 Ga0123355_10025709 3300009826 Bacteria 9481
16 Ga0123356_10005584 3300010049 Bacteria 12791
17 Ga0123356_10022857 3300010049 Bacteria 5897
18 Ga0123353_10034826 3300010167 Bacteria 7868
19 Ga0123353_10111014 3300010167 Bacteria 4417
20 Ga0123353_10138061 3300010167 Bacteria 3909
21 Ga0466712_037983 3300042614 Bacteria 12191
22 Ga0466712_296032 3300042614 Bacteria 21817
23 Ga0466718_030169 3300042617 Unclassified 7290
24 Ga0466720_007470 3300042607 Bacteria 49010
25 Ga0466721_094341 3300042608 Bacteria 36475
26 Ga0466722_067351 3300042609 Bacteria 51487
27 Ga0466729_282411 3300042621 Bacteria 6891
28 Ga0466702_204397 3300042635 Unclassified 3945
29 Ga0072941_1035084 3300005201 Bacteria 9775
30 Ga0466696_344329 3300042596 Bacteria 5546
31 Ga0123356_10356163 3300010049 Bacteria 1589
32 Ga0123356_10382239 3300010049 Bacteria 1541
33 Ga0123353_10300283 3300010167 Bacteria 2452
34 Ga0466718_018071 3300042617 Unclassified 9811
35 Ga0466718_090025 3300042617 Unclassified 15108
36 Ga0466706_052531 3300042599 Bacteria 4764
37 Ga0466717_042983 3300042604 Bacteria 2095
38 Ga0466720_050028 3300042607 Bacteria 93115
39 Ga0466730_063479 3300042625 Bacteria 44022
40 Ga0466703_137417 3300042636 Bacteria 6558
41 Ga0466704_424510 3300042643 Unclassified 1741
42 2230929979 2228664001 Unclassified 6395
43 JGI24695J34938_10003190 3300002450 Bacteria 11628
44 CVPL010W_10002843 3300002931 Bacteria 20148
45 Ga0072940_1004334 3300005200 Unclassified 9895
46 Ga0072941_1014362 3300005201 Bacteria 28449
47 Ga0072941_1037351 3300005201 Unclassified 16442
48 Ga0072941_1054504 3300005201 Bacteria 7250
49 Ga0264413_102892 3300024493 Unclassified 13118
50 Ga0264413_103541 3300024493 Bacteria 11905
51 Ga0466691_066382 3300042593 Bacteria 7235
52 Ga0123356_10015172 3300010049 Bacteria 7386
53 Ga0123356_10399332 3300010049 Bacteria 1512
54 Ga0123353_10152468 3300010167 Unclassified 3688
55 Ga0123353_10440941 3300010167 Bacteria 1921
56 Ga0123353_10477881 3300010167 Bacteria 1824
57 Ga0466718_149888 3300042617 Unclassified 4562
58 Ga0466706_217297 3300042599 Bacteria 3011
59 Ga0466709_118290 3300042648 Bacteria 5953
60 AustNasuHG_c1003368 3300000089 Bacteria 5774
61 JGI24698J34947_10012942 3300002449 Unclassified 4559
62 JGI24695J34938_10013020 3300002450 Unclassified 4384
63 Ga0415639_161467 3300038395 Bacteria 1877
64 Ga0466696_067962 3300042596 Bacteria 14049
65 Ga0123355_10675236 3300009826 Bacteria 1196
66 Ga0123356_10047847 3300010049 Bacteria 3979
67 Ga0123356_10048497 3300010049 Bacteria 3952
68 Ga0123356_10127930 3300010049 Bacteria 2483
69 Ga0123354_10198356 3300010882 Bacteria 2217
70 Ga0466705_432729 3300042612 Bacteria 55378
71 Ga0466715_117799 3300042616 Bacteria 1999
72 Ga0466726_035617 3300042619 Bacteria 12257
73 Ga0466719_297526 3300042606 Bacteria 28445
74 Ga0466720_109553 3300042607 Unclassified 27672
75 Ga0466698_375529 3300042610 Unclassified 1715
76 Ga0466705_140978 3300042612 Bacteria 8865
77 Ga0466731_374566 3300042622 Bacteria 5651
78 Ga0466702_286040 3300042635 Unclassified 1240
79 Ga0466702_448627 3300042635 Bacteria 11495
80 AustNasuHG_c1045610 3300000089 Unclassified 1000
81 Ga0072941_1004457 3300005201 Bacteria 19474
82 Ga0466690_408944 3300042590 Bacteria 5419
83 Ga0466732_171515 3300042656 Archaea 1384
84 Ga0123355_10187905 3300009826 Bacteria 3050
85 Ga0123356_10113773 3300010049 Bacteria 2619
86 Ga0123356_10443494 3300010049 Bacteria 1445
87 Ga0123356_11085716 3300010049 Bacteria 969
88 Ga0123353_10132479 3300010167 Bacteria 3999
89 Ga0466705_397052 3300042612 Bacteria 4429
90 Ga0466728_121798 3300042620 Bacteria 2829
91 Ga0466714_016426 3300042603 Bacteria 18818
92 Ga0466719_082011 3300042606 Bacteria 2207
93 Ga0466703_022345 3300042636 Bacteria 41652
94 Ga0466709_302719 3300042648 Bacteria 2180
95 Ga0466725_038924 3300042654 Bacteria 9866
96 JGI24695J34938_10010085 3300002450 Bacteria 5206
97 Ga0068302_10002987 3300005071 Bacteria 33512
98 Ga0072940_1026895 3300005200 Unclassified 8315
99 Ga0072941_1072193 3300005201 Unclassified 10162
100 Ga0466696_472700 3300042596 Bacteria 2183
101 Ga0123356_10000006 3300010049 Bacteria 247371
102 Ga0466712_182106 3300042614 Bacteria 1767
103 Ga0466704_007949 3300042643 Bacteria 5065
104 JGI24696J40584_12961719 3300002834 Bacteria 72636
105 Ga0072940_1009133 3300005200 Bacteria 7616
106 Ga0072940_1029227 3300005200 Unclassified 2970
107 Ga0072941_1000047 3300005201 Bacteria 107170
108 Ga0102738_1002447 3300007141 Bacteria 2771
109 Ga0415639_239354 3300038395 Bacteria 1132
110 Ga0466694_020212 3300042594 Unclassified 8350
111 Ga0466694_048822 3300042594 Bacteria 9383
112 Ga0123355_10085790 3300009826 Unclassified 5009
113 Ga0123356_10005376 3300010049 Bacteria 13047
114 Ga0123356_10038186 3300010049 Bacteria 4475
115 Ga0123356_10078118 3300010049 Unclassified 3123
116 Ga0123356_10216188 3300010049 Bacteria 1970
117 Ga0123356_10324372 3300010049 Bacteria 1654
118 Ga0466712_065804 3300042614 Bacteria 33390
119 Ga0466715_077272 3300042616 Bacteria 6751
120 Ga0466718_131678 3300042617 Unclassified 1281
121 Ga0466718_146389 3300042617 Bacteria 14038
122 Ga0466720_051774 3300042607 Bacteria 19884
123 Ga0466702_137249 3300042635 Bacteria 2105
124 Ga0466702_353009 3300042635 Unclassified 1134
125 Ga0466703_408581 3300042636 Bacteria 1615
126 AustNasuHG_c1000867 3300000089 Unclassified 10884
127 Ga0072941_1003328 3300005201 Bacteria 50972
128 Ga0466694_064587 3300042594 Unclassified 2771
129 Ga0466694_319537 3300042594 Bacteria 7751
130 Ga0466699_033447 3300042597 Bacteria 6312

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 54 243 0.98
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 60 291 0.97
PF08659 KR KR domain 55 207 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.