Protein Family IF05011

Metagenome Isolate
230 Members
69 Samples
204 Scaffolds
854.41 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_196912|Ga0466694_196912_16158_19052
Length
942 aa
Sequence
MFASSFHYITIDKNVNSLYCYIMHYIDLPVYKNHQKILSALEHNQVLVVESPTGSGKTTQLPVILHEAGCSRNGIIGVTQPRRIAAVSVSEFIARQMGTAIPGLIGYKMRFEDRTSQQTKIKILTDGMLLQEMKLDPWLSKYSVIIVDEAHERSLTIDFILGLLKRVLESRRDFKVIVSSATINAEVFSAYFGECPVVKIEAQRFPVTLIYDPPLGGTNSPALAGAPASASGEVESPAYEQPRRGRRRDSASRFRGRDDMGGGKNSSESAAEALLVKIEAIISRFIAEKREGDILVFLSGEKMIKECMNRLSLSPAGKFLYLLPLYGRLGKEEQERVFEAAPRGKTKVVVATNIAETSVTIDGITAVIDSGLAKLNWYNPRSFTSSLIEAPVSKASANQRKGRAGRTREGVCYRLYTRRDFENRPLFTTEEIFRTDLSEVILRMAELGITNFEDFDFISVPEKEGLIAGIETLNLLHALEPDRSLSNIGKLMTEFPLAPRQSRIIVEAVLRYPQVLRETVIAAAFLSTQSPYLLPPGEETDARKAHXXFRDDDGDFVSYLKLFSAYADSTNRGKFCERNYIDDRAMAEIVNVAAQLEEILANLKIPVLEGAQNKHSEAVWMDDVTRPSPKESISKIKGGFALANPAGGKVSDYLCCIGRGMIQFVCIREGGRSDSGRSPGRNTSYRSLTADRIIIHPGSVMFRSDPKYIVAGEIVRTSRMYAMSVSPLSREILEELGLGAQERKPKRARDFTNNIKIAGEVFEIKTIKGKKTAILPWERLALIRDSIPAETVYKGLKGCVTVRDKETDAFPYTLLAGEKLELILSLAPALDPENALTRECPRKRTFNSGSGKADGLAALLQYMDSLVKPVLWKKGAKEFGFLGLFTDGGGNYWLRSSRGFHTSLNESLASLEALIDEMGGEVDIDSKHTVNQTYRRLAEYIG

📊 Sample Types

Isolate 11.3%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.2%
Termitidae 29.4%
Kalotermitidae 20.6%
Rhinotermitidae 5.9%
Termopsidae 2.9%
Hodotermitidae 1.5%
Blaberidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 219
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
16 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2772190975 Treponema sp. RmG30 Isolate Blaberidae
26 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
27 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
28 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
29 650716102 Treponema primitia ZAS-2 Isolate Unclassified
30 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
31 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
32 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
33 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
40 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
41 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
44 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
45 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
46 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
47 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
56 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
57 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
58 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
59 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
60 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
64 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
65 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_209667 3300042659 Bacteria 67326
2 Ga0466715_002249 3300042616 Bacteria 18745
3 Ga0466718_046191 3300042617 Bacteria 10470
4 Ga0466723_084581 3300042618 Bacteria 2944
5 Ga0466723_159955 3300042618 Unclassified 2822
6 Ga0466723_226036 3300042618 Unclassified 4405
7 Ga0123356_10006206 3300010049 Bacteria 12086
8 Ga0123354_10058553 3300010882 Bacteria 5723
9 Ga0466692_048549 3300042591 Bacteria 10540
10 Ga0466692_055371 3300042591 Bacteria 40976
11 Ga0466693_029666 3300042592 Bacteria 5664
12 Ga0466691_083100 3300042593 Bacteria 10967
13 Ga0466696_025993 3300042596 Bacteria 11411
14 Ga0466699_230776 3300042597 Bacteria 11603
15 Ga0466699_241276 3300042597 Bacteria 21130
16 Ga0466713_133120 3300042602 Bacteria 5299
17 Ga0466719_337437 3300042606 Bacteria 3187
18 AustNasuHG_c1001573 3300000089 Bacteria 8227
19 JGI24698J34947_10000145 3300002449 Bacteria 26759
20 JGI24695J34938_10000637 3300002450 Bacteria 33482
21 JGI24702J35022_10000854 3300002462 Bacteria 18852
22 Ga0466705_168737 3300042612 Bacteria 19471
23 Ga0466705_199386 3300042612 Bacteria 13309
24 Ga0466703_292012 3300042636 Bacteria 42783
25 Ga0466703_433291 3300042636 Bacteria 24943
26 Ga0466708_061532 3300042652 Bacteria 43570
27 Ga0466708_417541 3300042652 Bacteria 43144
28 Ga0466705_402824 3300042612 Bacteria 6688
29 Ga0466712_120010 3300042614 Bacteria 41166
30 Ga0466712_127573 3300042614 Bacteria 29541
31 Ga0466715_105087 3300042616 Bacteria 8320
32 Ga0466715_349454 3300042616 Bacteria 41739
33 Ga0466718_133490 3300042617 Bacteria 9113
34 Ga0466723_041965 3300042618 Bacteria 12933
35 Ga0123353_10172211 3300010167 Bacteria 3435
36 Ga0466690_017998 3300042590 Bacteria 3455
37 Ga0466690_323130 3300042590 Bacteria 5032
38 Ga0466692_032782 3300042591 Bacteria 5962
39 Ga0466691_114347 3300042593 Bacteria 9140
40 Ga0466699_124768 3300042597 Bacteria 4075
41 Ga0466716_307051 3300042605 Unclassified 3835
42 Ga0466722_133482 3300042609 Bacteria 7243
43 JGI24695J34938_10000310 3300002450 Bacteria 48067
44 JGI24695J34938_10003849 3300002450 Bacteria 10183
45 JGI24695J34938_10006193 3300002450 Bacteria 7268
46 JGI24695J34938_10012486 3300002450 Bacteria 4499
47 JGI24695J34938_10024778 3300002450 Bacteria 2877
48 Ga0072941_1006420 3300005201 Bacteria 4911
49 Ga0466705_031663 3300042612 Bacteria 3728
50 Ga0466703_082982 3300042636 Bacteria 4015
51 Ga0466703_170770 3300042636 Bacteria 3710
52 Ga0466709_049393 3300042648 Unclassified 6327
53 Ga0466733_067829 3300042659 Bacteria 52214
54 Ga0466718_067874 3300042617 Bacteria 57908
55 Ga0466728_004738 3300042620 Bacteria 32651
56 Ga0123356_10000325 3300010049 Bacteria 54913
57 Ga0123356_10000609 3300010049 Bacteria 39509
58 Ga0123354_10149275 3300010882 Bacteria 2842
59 Ga0466691_060866 3300042593 Bacteria 10277
60 Ga0466691_166247 3300042593 Bacteria 3673
61 Ga0466694_087301 3300042594 Bacteria 37116
62 Ga0466694_405994 3300042594 Bacteria 18900
63 Ga0466699_056838 3300042597 Bacteria 14378
64 Ga0466719_339402 3300042606 Bacteria 28715
65 Ga0466698_503901 3300042610 Bacteria 3413
66 AustNasuHG_c1000802 3300000089 Bacteria 11275
67 JGI24695J34938_10001123 3300002450 Bacteria 24039
68 JGI24695J34938_10004480 3300002450 Bacteria 9139
69 JGI24695J34938_10011613 3300002450 Bacteria 4736
70 JGI24702J35022_10007844 3300002462 Bacteria 6083
71 JGI24700J35501_10930886 3300002508 Bacteria 34158
72 Ga0068305_10013580 3300005083 Bacteria 22922
73 Ga0466729_286239 3300042621 Bacteria 3643
74 Ga0466704_077265 3300042643 Bacteria 7114
75 Ga0466704_137840 3300042643 Bacteria 22708
76 Ga0466708_010700 3300042652 Bacteria 13876
77 Ga0466708_090364 3300042652 Bacteria 14538
78 Ga0466712_294604 3300042614 Bacteria 7093
79 Ga0466711_198592 3300042615 Bacteria 7328
80 Ga0466723_009774 3300042618 Bacteria 11962
81 Ga0466723_364265 3300042618 Bacteria 16673
82 Ga0466690_092774 3300042590 Bacteria 20892
83 Ga0466691_033820 3300042593 Bacteria 16292
84 Ga0466694_196912 3300042594 Bacteria 19179
85 Ga0466696_035013 3300042596 Unclassified 4028
86 Ga0466719_062039 3300042606 Bacteria 13312
87 JGI24698J34947_10022565 3300002449 Bacteria 3374
88 JGI24695J34938_10000334 3300002450 Bacteria 46476
89 JGI24695J34938_10003396 3300002450 Bacteria 11171
90 JGI24695J34938_10006821 3300002450 Bacteria 6779
91 JGI24695J34938_10007478 3300002450 Bacteria 6390
92 JGI24695J34938_10011508 3300002450 Bacteria 4760
93 JGI24695J34938_10017870 3300002450 Bacteria 3561
94 Ga0068305_10006630 3300005083 Bacteria 7353
95 Ga0466705_268244 3300042612 Bacteria 4856
96 Ga0466703_121472 3300042636 Bacteria 13448
97 Ga0466709_034771 3300042648 Bacteria 5485
98 Ga0466708_014307 3300042652 Bacteria 11146
99 Ga0466708_248625 3300042652 Bacteria 24324
100 Ga0466733_005516 3300042659 Bacteria 11914
101 Ga0466711_183350 3300042615 Bacteria 47393
102 Ga0466715_019399 3300042616 Bacteria 5988
103 Ga0466715_118825 3300042616 Bacteria 5077
104 Ga0466715_168050 3300042616 Unclassified 8382
105 Ga0466723_040514 3300042618 Bacteria 5492
106 Ga0466723_046495 3300042618 Bacteria 25534
107 Ga0466723_060645 3300042618 Bacteria 8375
108 Ga0466723_282735 3300042618 Bacteria 13401
109 Ga0466728_127158 3300042620 Bacteria 4445
110 Ga0466728_228113 3300042620 Bacteria 4228
111 Ga0466728_325263 3300042620 Bacteria 9286
112 Ga0123356_10000046 3300010049 Bacteria 130593
113 Ga0123356_10005076 3300010049 Bacteria 13498
114 Ga0415639_013178 3300038395 Bacteria 10367
115 Ga0466692_092074 3300042591 Bacteria 19999
116 Ga0466692_180155 3300042591 Bacteria 17645
117 Ga0466699_058688 3300042597 Bacteria 6417
118 Ga0466716_045671 3300042605 Bacteria 17650
119 Ga0466722_031461 3300042609 Bacteria 6881
120 Ga0466722_053018 3300042609 Bacteria 4886
121 Ga0466722_058526 3300042609 Bacteria 27862
122 JGI24698J34947_10000007 3300002449 Bacteria 54610
123 JGI24698J34947_10013163 3300002449 Unclassified 4520
124 JGI24695J34938_10002037 3300002450 Bacteria 15977
125 JGI24697J35500_11274788 3300002507 Bacteria 9799
126 Ga0466705_379518 3300042612 Bacteria 16542
127 Ga0466711_180338 3300042615 Bacteria 18953
128 Ga0466715_346781 3300042616 Bacteria 4572
129 Ga0466715_396299 3300042616 Unclassified 2891
130 Ga0466723_013457 3300042618 Bacteria 25413
131 Ga0466723_022086 3300042618 Unclassified 5905
132 Ga0466723_180833 3300042618 Bacteria 25421
133 Ga0466728_230846 3300042620 Bacteria 44677
134 Ga0123356_10004231 3300010049 Bacteria 14844
135 Ga0123356_10048647 3300010049 Bacteria 3946
136 Ga0123353_10235085 3300010167 Bacteria 2853
137 Ga0456237_0001047 3300041968 Bacteria 4381
138 Ga0466690_405505 3300042590 Unclassified 6372
139 Ga0466692_039053 3300042591 Bacteria 10267
140 Ga0466692_137526 3300042591 Bacteria 3293
141 Ga0466692_169455 3300042591 Bacteria 10459
142 Ga0466691_176542 3300042593 Bacteria 11992
143 Ga0466699_005101 3300042597 Bacteria 13919
144 Ga0466699_025495 3300042597 Bacteria 2937
145 Ga0466706_284011 3300042599 Bacteria 3327
146 Ga0466716_094204 3300042605 Bacteria 2773
147 Ga0466719_140994 3300042606 Bacteria 18213
148 Ga0466720_055998 3300042607 Bacteria 9531
149 Ga0466722_227065 3300042609 Bacteria 3676
150 JGI24695J34938_10003145 3300002450 Bacteria 11752
151 JGI24702J35022_10008361 3300002462 Bacteria 5860
152 Ga0466705_027405 3300042612 Bacteria 7582
153 Ga0466705_188143 3300042612 Bacteria 5452
154 Ga0466703_108352 3300042636 Bacteria 39848
155 Ga0466703_167615 3300042636 Bacteria 7419
156 Ga0466704_024511 3300042643 Bacteria 22738
157 Ga0466709_192362 3300042648 Bacteria 5086
158 Ga0466708_017522 3300042652 Bacteria 16689
159 Ga0466732_170875 3300042656 Bacteria 3176
160 Ga0466733_144223 3300042659 Bacteria 4170
161 Ga0466711_197961 3300042615 Bacteria 14058
162 Ga0466718_053847 3300042617 Bacteria 7652
163 Ga0466723_058914 3300042618 Unclassified 6207
164 Ga0466723_128337 3300042618 Bacteria 3419
165 Ga0466723_204079 3300042618 Bacteria 8093
166 Ga0466726_336565 3300042619 Bacteria 4236
167 Ga0466728_233151 3300042620 Bacteria 7899
168 Ga0123356_10006026 3300010049 Bacteria 12293
169 Ga0123356_10023221 3300010049 Bacteria 5840
170 Ga0123353_10103298 3300010167 Bacteria 4594
171 Ga0466692_009736 3300042591 Bacteria 4572
172 Ga0466692_194825 3300042591 Bacteria 10966
173 Ga0466693_189878 3300042592 Bacteria 3035
174 Ga0466691_109641 3300042593 Bacteria 14703
175 Ga0466691_221840 3300042593 Bacteria 12679
176 Ga0466719_180187 3300042606 Bacteria 25290
177 Ga0466703_043418 3300042636 Bacteria 22331
178 Ga0466709_163588 3300042648 Bacteria 9544
179 Ga0466712_008021 3300042614 Bacteria 58516
180 Ga0415639_037778 3300038395 Bacteria 8286
181 Ga0466693_154922 3300042592 Bacteria 6634
182 Ga0466691_148704 3300042593 Bacteria 29567
183 Ga0466694_188429 3300042594 Bacteria 57168
184 Ga0466694_197691 3300042594 Bacteria 23512
185 Ga0466696_102907 3300042596 Bacteria 26617
186 Ga0466696_244862 3300042596 Bacteria 20694
187 Ga0466696_246533 3300042596 Bacteria 13710
188 Ga0466699_122116 3300042597 Bacteria 11047
189 Ga0466699_174555 3300042597 Bacteria 3909
190 Ga0466713_115360 3300042602 Bacteria 5505
191 Ga0466716_195757 3300042605 Bacteria 3996
192 Ga0466719_121580 3300042606 Bacteria 35540
193 Ga0466721_055675 3300042608 Bacteria 4612
194 Ga0466722_175085 3300042609 Bacteria 8837
195 JGI24698J34947_10003755 3300002449 Bacteria 8273
196 JGI24698J34947_10014725 3300002449 Bacteria 4261
197 JGI24698J34947_10018912 3300002449 Bacteria 3720
198 JGI24695J34938_10000064 3300002450 Bacteria 87537
199 Ga0072941_1008822 3300005201 Bacteria 8071
200 Ga0466735_130585 3300042624 Bacteria 11129
201 Ga0466704_175118 3300042643 Bacteria 18728
202 Ga0466704_427526 3300042643 Bacteria 4321
203 Ga0466704_445716 3300042643 Bacteria 38256
204 Ga0466709_082284 3300042648 Bacteria 24819

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00271 Helicase_C Helicase conserved C-terminal domain 279 407 0.85
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 656 737 0.85
PF00270 DEAD DEAD/DEAH box helicase 33 186 0.71

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.