Protein Family IF04979
Metagenome
Isolate
194
Members
53
Samples
174
Scaffolds
265.74
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_075104|Ga0466694_075104_26927_27844
- Length
- 298 aa
- Sequence
- MNLLISALRNRFDLDVWLLESDYKELMMKVRLISILMGAFVLTGLFAGGKQDTGSQQNTAVSAAPYTIEVGGSTSVTPLMEQFAAEYEKVKSHIKVNDGIKNADVIYQIGMSSRELTPAEQGRGLKEVIVAIDGIAVIINNNNPVSNLTVDEIRNIYTGAITDWSQVSNGAKKGKIAVVSREEGSGTRGAFEELVGFQGKLLAGANESTSTGAIKAGIAQNPDAIGYISLGSVDNTIKAVSVGTVAATNDNVKNGSYKIARPFIILYGNSLHAESDAFIKWIGGSEGQAITKKSYVLP
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Unclassified
37.3%
Kalotermitidae
7.8%
Rhinotermitidae
5.9%
Taxonomy
Archaea
1
Bacteria
184
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 2 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 3 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 4 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 5 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 6 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 9 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 17 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 31 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 49 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 50 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 51 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_044841 | 3300042659 | Bacteria | 1261 |
| 2 | AustNasuHG_c1009637 | 3300000089 | Bacteria | 3384 |
| 3 | JGI24698J34947_10003481 | 3300002449 | Bacteria | 8542 |
| 4 | JGI24698J34947_10043247 | 3300002449 | Bacteria | 2310 |
| 5 | JGI24698J34947_10057134 | 3300002449 | Bacteria | 1937 |
| 6 | JGI24698J34947_10066749 | 3300002449 | Bacteria | 1749 |
| 7 | JGI24698J34947_10085195 | 3300002449 | Bacteria | 1469 |
| 8 | JGI24698J34947_10111483 | 3300002449 | Bacteria | 1207 |
| 9 | JGI24698J34947_10114659 | 3300002449 | Bacteria | 1182 |
| 10 | JGI24698J34947_10132175 | 3300002449 | Bacteria | 1065 |
| 11 | JGI24695J34938_10018398 | 3300002450 | Bacteria | 3494 |
| 12 | Ga0072941_1096561 | 3300005201 | Bacteria | 1096 |
| 13 | Ga0466712_004637 | 3300042614 | Bacteria | 2614 |
| 14 | Ga0466712_015925 | 3300042614 | Bacteria | 11922 |
| 15 | Ga0466712_030703 | 3300042614 | Bacteria | 18975 |
| 16 | Ga0466712_030875 | 3300042614 | Bacteria | 1415 |
| 17 | Ga0466712_121516 | 3300042614 | Bacteria | 3369 |
| 18 | Ga0466712_170229 | 3300042614 | Unclassified | 2191 |
| 19 | Ga0466718_037580 | 3300042617 | Bacteria | 5402 |
| 20 | Ga0466729_070003 | 3300042621 | Bacteria | 1641 |
| 21 | Ga0415639_005305 | 3300038395 | Bacteria | 16909 |
| 22 | Ga0466692_136918 | 3300042591 | Bacteria | 1324 |
| 23 | Ga0466692_158381 | 3300042591 | Bacteria | 3709 |
| 24 | Ga0466691_081910 | 3300042593 | Bacteria | 24279 |
| 25 | Ga0466694_102439 | 3300042594 | Bacteria | 2308 |
| 26 | Ga0466694_122805 | 3300042594 | Bacteria | 1693 |
| 27 | Ga0466694_341089 | 3300042594 | Bacteria | 6447 |
| 28 | Ga0466699_213064 | 3300042597 | Bacteria | 4663 |
| 29 | Ga0466730_014468 | 3300042625 | Bacteria | 1351 |
| 30 | Ga0466720_080343 | 3300042607 | Bacteria | 15819 |
| 31 | Ga0466720_115567 | 3300042607 | Bacteria | 8267 |
| 32 | AustNasuHG_c1022528 | 3300000089 | Bacteria | 2022 |
| 33 | JGI24698J34947_10083585 | 3300002449 | Bacteria | 1489 |
| 34 | JGI24695J34938_10007678 | 3300002450 | Bacteria | 6263 |
| 35 | Ga0072941_1006601 | 3300005201 | Bacteria | 4621 |
| 36 | Ga0072941_1009209 | 3300005201 | Bacteria | 4943 |
| 37 | Ga0072941_1033337 | 3300005201 | Bacteria | 11508 |
| 38 | Ga0072941_1246619 | 3300005201 | Bacteria | 1663 |
| 39 | Ga0466712_028680 | 3300042614 | Bacteria | 4216 |
| 40 | Ga0466712_077272 | 3300042614 | Bacteria | 17024 |
| 41 | Ga0415639_002561 | 3300038395 | Bacteria | 25136 |
| 42 | Ga0415639_174544 | 3300038395 | Unclassified | 2286 |
| 43 | Ga0466694_088913 | 3300042594 | Bacteria | 2426 |
| 44 | Ga0466694_207034 | 3300042594 | Bacteria | 2507 |
| 45 | Ga0466699_070370 | 3300042597 | Bacteria | 1272 |
| 46 | Ga0466699_358685 | 3300042597 | Bacteria | 2437 |
| 47 | Ga0123356_10062699 | 3300010049 | Bacteria | 3473 |
| 48 | Ga0123356_10280798 | 3300010049 | Bacteria | 1760 |
| 49 | Ga0123356_11278309 | 3300010049 | Bacteria | 898 |
| 50 | Ga0466702_365689 | 3300042635 | Bacteria | 1986 |
| 51 | Ga0466702_396700 | 3300042635 | Bacteria | 1916 |
| 52 | Ga0466722_092582 | 3300042609 | Bacteria | 3563 |
| 53 | Ga0466722_102216 | 3300042609 | Bacteria | 8046 |
| 54 | Ga0466722_132267 | 3300042609 | Bacteria | 39034 |
| 55 | AustNasuHG_c1024701 | 3300000089 | Bacteria | 1899 |
| 56 | JGI24698J34947_10041218 | 3300002449 | Archaea | 2379 |
| 57 | JGI24698J34947_10081626 | 3300002449 | Bacteria | 1515 |
| 58 | JGI24698J34947_10146371 | 3300002449 | Unclassified | 987 |
| 59 | JGI24695J34938_10012382 | 3300002450 | Bacteria | 4522 |
| 60 | JGI24695J34938_10014220 | 3300002450 | Bacteria | 4137 |
| 61 | Ga0466712_008558 | 3300042614 | Bacteria | 10675 |
| 62 | Ga0466712_298591 | 3300042614 | Bacteria | 10678 |
| 63 | Ga0466692_083899 | 3300042591 | Bacteria | 3339 |
| 64 | Ga0466699_214764 | 3300042597 | Bacteria | 2452 |
| 65 | Ga0466699_288680 | 3300042597 | Bacteria | 2265 |
| 66 | Ga0466702_100956 | 3300042635 | Bacteria | 39373 |
| 67 | Ga0466705_355023 | 3300042612 | Bacteria | 33559 |
| 68 | JGI24698J34947_10008557 | 3300002449 | Bacteria | 5617 |
| 69 | JGI24698J34947_10069548 | 3300002449 | Bacteria | 1698 |
| 70 | JGI24698J34947_10116470 | 3300002449 | Bacteria | 1169 |
| 71 | JGI24698J34947_10144965 | 3300002449 | Unclassified | 994 |
| 72 | JGI24695J34938_10000272 | 3300002450 | Bacteria | 50568 |
| 73 | JGI24695J34938_10010208 | 3300002450 | Unclassified | 5166 |
| 74 | Ga0072940_1019821 | 3300005200 | Bacteria | 2603 |
| 75 | Ga0072941_1002429 | 3300005201 | Bacteria | 39736 |
| 76 | Ga0072941_1003272 | 3300005201 | Bacteria | 13396 |
| 77 | Ga0072941_1012700 | 3300005201 | Bacteria | 3762 |
| 78 | Ga0072941_1018360 | 3300005201 | Bacteria | 13367 |
| 79 | Ga0466712_184545 | 3300042614 | Bacteria | 1578 |
| 80 | Ga0466718_033184 | 3300042617 | Bacteria | 15825 |
| 81 | Ga0466723_077145 | 3300042618 | Bacteria | 54484 |
| 82 | Ga0466692_132659 | 3300042591 | Bacteria | 4827 |
| 83 | Ga0466692_178314 | 3300042591 | Bacteria | 4138 |
| 84 | Ga0466692_182376 | 3300042591 | Bacteria | 6508 |
| 85 | Ga0466694_186073 | 3300042594 | Bacteria | 3509 |
| 86 | Ga0466694_344878 | 3300042594 | Bacteria | 2497 |
| 87 | Ga0123355_10010716 | 3300009826 | Bacteria | 14082 |
| 88 | Ga0123356_10468720 | 3300010049 | Bacteria | 1410 |
| 89 | Ga0466731_046614 | 3300042622 | Bacteria | 1400 |
| 90 | Ga0466722_049289 | 3300042609 | Bacteria | 1428 |
| 91 | JGI24698J34947_10007146 | 3300002449 | Bacteria | 6135 |
| 92 | JGI24698J34947_10026600 | 3300002449 | Bacteria | 3074 |
| 93 | JGI24695J34938_10028135 | 3300002450 | Bacteria | 2645 |
| 94 | JGI24699J35502_11051521 | 3300002509 | Bacteria | 1656 |
| 95 | Ga0072941_1014135 | 3300005201 | Bacteria | 4308 |
| 96 | Ga0072941_1028753 | 3300005201 | Bacteria | 17830 |
| 97 | Ga0072941_1141881 | 3300005201 | Bacteria | 1132 |
| 98 | Ga0466712_009546 | 3300042614 | Bacteria | 12932 |
| 99 | Ga0466712_060549 | 3300042614 | Bacteria | 6695 |
| 100 | Ga0466712_285453 | 3300042614 | Bacteria | 11443 |
| 101 | Ga0466718_120716 | 3300042617 | Bacteria | 5164 |
| 102 | Ga0466692_000604 | 3300042591 | Bacteria | 5406 |
| 103 | Ga0466692_190476 | 3300042591 | Bacteria | 1053 |
| 104 | Ga0466694_177757 | 3300042594 | Bacteria | 2562 |
| 105 | Ga0123355_10117833 | 3300009826 | Bacteria | 4128 |
| 106 | Ga0123356_10000299 | 3300010049 | Bacteria | 57073 |
| 107 | Ga0123356_10009030 | 3300010049 | Bacteria | 9864 |
| 108 | Ga0123356_10087018 | 3300010049 | Bacteria | 2967 |
| 109 | Ga0123356_10342110 | 3300010049 | Bacteria | 1617 |
| 110 | Ga0466729_296228 | 3300042621 | Bacteria | 1729 |
| 111 | Ga0466702_170548 | 3300042635 | Bacteria | 1481 |
| 112 | JGI24698J34947_10000067 | 3300002449 | Bacteria | 32875 |
| 113 | JGI24698J34947_10041240 | 3300002449 | Bacteria | 2378 |
| 114 | JGI24695J34938_10004189 | 3300002450 | Bacteria | 9583 |
| 115 | JGI24695J34938_10032833 | 3300002450 | Bacteria | 2394 |
| 116 | Ga0072941_1059661 | 3300005201 | Bacteria | 4304 |
| 117 | Ga0072941_1138958 | 3300005201 | Bacteria | 3190 |
| 118 | Ga0074263_115276 | 3300005485 | Bacteria | 2085 |
| 119 | Ga0466712_105681 | 3300042614 | Bacteria | 1093 |
| 120 | Ga0264413_102957 | 3300024493 | Bacteria | 2951 |
| 121 | Ga0123356_10014814 | 3300010049 | Bacteria | 7488 |
| 122 | Ga0123353_10060205 | 3300010167 | Unclassified | 6089 |
| 123 | Ga0466702_218285 | 3300042635 | Bacteria | 19292 |
| 124 | Ga0466704_153406 | 3300042643 | Bacteria | 40156 |
| 125 | Ga0466720_129874 | 3300042607 | Bacteria | 9649 |
| 126 | JGI24698J34947_10018265 | 3300002449 | Bacteria | 3792 |
| 127 | JGI24698J34947_10111255 | 3300002449 | Bacteria | 1208 |
| 128 | JGI24698J34947_10120627 | 3300002449 | Bacteria | 1139 |
| 129 | JGI24695J34938_10010223 | 3300002450 | Bacteria | 5160 |
| 130 | JGI24697J35500_11273592 | 3300002507 | Bacteria | 5803 |
| 131 | Ga0466712_059856 | 3300042614 | Bacteria | 35187 |
| 132 | Ga0466712_260184 | 3300042614 | Bacteria | 2064 |
| 133 | Ga0264413_115370 | 3300024493 | Bacteria | 7040 |
| 134 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 135 | Ga0466694_036096 | 3300042594 | Bacteria | 7424 |
| 136 | Ga0466694_156129 | 3300042594 | Bacteria | 74614 |
| 137 | Ga0466699_002311 | 3300042597 | Bacteria | 5839 |
| 138 | Ga0466699_213005 | 3300042597 | Bacteria | 2670 |
| 139 | Ga0466699_228025 | 3300042597 | Bacteria | 6350 |
| 140 | Ga0123356_10003195 | 3300010049 | Bacteria | 17219 |
| 141 | Ga0123356_10005713 | 3300010049 | Bacteria | 12635 |
| 142 | Ga0123356_10996728 | 3300010049 | Bacteria | 1008 |
| 143 | Ga0123353_10153362 | 3300010167 | Bacteria | 3676 |
| 144 | Ga0466729_316842 | 3300042621 | Bacteria | 1392 |
| 145 | Ga0466722_082424 | 3300042609 | Bacteria | 1670 |
| 146 | Ga0466732_303487 | 3300042656 | Bacteria | 11255 |
| 147 | JGI24698J34947_10017644 | 3300002449 | Bacteria | 3865 |
| 148 | JGI24698J34947_10024239 | 3300002449 | Unclassified | 3242 |
| 149 | JGI24698J34947_10035689 | 3300002449 | Bacteria | 2594 |
| 150 | JGI24698J34947_10036883 | 3300002449 | Bacteria | 2543 |
| 151 | JGI24698J34947_10103505 | 3300002449 | Unclassified | 1273 |
| 152 | JGI24698J34947_10151046 | 3300002449 | Bacteria | 964 |
| 153 | JGI24695J34938_10001613 | 3300002450 | Bacteria | 18940 |
| 154 | JGI24695J34938_10004340 | 3300002450 | Bacteria | 9341 |
| 155 | JGI24695J34938_10014995 | 3300002450 | Bacteria | 3993 |
| 156 | JGI24695J34938_10049982 | 3300002450 | Unclassified | 1836 |
| 157 | Ga0072940_1029838 | 3300005200 | Bacteria | 3537 |
| 158 | Ga0072941_1029046 | 3300005201 | Bacteria | 3304 |
| 159 | Ga0466712_319512 | 3300042614 | Bacteria | 9452 |
| 160 | Ga0466718_052515 | 3300042617 | Bacteria | 9284 |
| 161 | Ga0466718_057114 | 3300042617 | Bacteria | 6416 |
| 162 | Ga0466692_193784 | 3300042591 | Bacteria | 1183 |
| 163 | Ga0466693_083009 | 3300042592 | Bacteria | 2198 |
| 164 | Ga0466694_075104 | 3300042594 | Bacteria | 33181 |
| 165 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
| 166 | Ga0466699_052562 | 3300042597 | Bacteria | 9226 |
| 167 | Ga0466699_070030 | 3300042597 | Bacteria | 21782 |
| 168 | Ga0466699_182753 | 3300042597 | Bacteria | 2613 |
| 169 | Ga0123357_10018474 | 3300009784 | Bacteria | 9269 |
| 170 | Ga0123356_10079847 | 3300010049 | Bacteria | 3091 |
| 171 | Ga0466702_036543 | 3300042635 | Bacteria | 2757 |
| 172 | Ga0466702_464417 | 3300042635 | Bacteria | 1914 |
| 173 | Ga0466717_152841 | 3300042604 | Bacteria | 1643 |
| 174 | Ga0466722_105401 | 3300042609 | Bacteria | 4522 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.