Protein Family IF04963
Metagenome
Metatranscriptome
Isolate
215
Members
45
Samples
212
Scaffolds
233.88
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_019833|Ga0466694_019833_960_1700
- Length
- 246 aa
- Sequence
- MGKRKKRKVDGPTGSEWLTTYSDMVTLMLCFFVIFFNPDDVTQSQLDAISASLQQGGLGALAGGLTFAAGNSAELGSTVMSLPSRERGRSLGTAMRKAVSVFSPEIRSNKVRVTHDERGVVITLASDAFFNPASARINIEATRDILLRLGSYLASNDENMVGRKFRIEGHTDSVDVDPSGPWESNWELSAARSISILHYLTDLGIEEKRFQIAGFADTAPVAGNNSPEGRAYNRRVDIIILDEGHL
Sample Types
Isolate
1.4%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
32.6%
Unclassified
11.6%
Termopsidae
9.3%
Rhinotermitidae
9.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_028821 | 3300042612 | Bacteria | 2199 |
| 2 | Ga0123353_10506997 | 3300010167 | Bacteria | 1756 |
| 3 | Ga0466735_063032 | 3300042624 | Bacteria | 2092 |
| 4 | Ga0466702_063047 | 3300042635 | Bacteria | 15583 |
| 5 | Ga0466703_007519 | 3300042636 | Bacteria | 18468 |
| 6 | Ga0466703_147244 | 3300042636 | Bacteria | 4659 |
| 7 | Ga0466703_329642 | 3300042636 | Bacteria | 8545 |
| 8 | Ga0466704_065747 | 3300042643 | Bacteria | 2205 |
| 9 | Ga0466704_197186 | 3300042643 | Bacteria | 8845 |
| 10 | Ga0466704_533092 | 3300042643 | Bacteria | 4455 |
| 11 | Ga0466727_308220 | 3300042655 | Bacteria | 1995 |
| 12 | Ga0072941_1067515 | 3300005201 | Bacteria | 4581 |
| 13 | Ga0466715_085266 | 3300042616 | Bacteria | 14198 |
| 14 | Ga0466723_257140 | 3300042618 | Bacteria | 26048 |
| 15 | Ga0466726_387390 | 3300042619 | Bacteria | 2202 |
| 16 | Ga0466707_102192 | 3300042601 | Bacteria | 1803 |
| 17 | Ga0466716_344329 | 3300042605 | Bacteria | 11903 |
| 18 | Ga0466720_028491 | 3300042607 | Bacteria | 76920 |
| 19 | Ga0466720_039827 | 3300042607 | Bacteria | 15944 |
| 20 | Ga0466720_054051 | 3300042607 | Bacteria | 3700 |
| 21 | Ga0466722_002377 | 3300042609 | Bacteria | 2018 |
| 22 | Ga0466690_040808 | 3300042590 | Bacteria | 26061 |
| 23 | Ga0466690_134140 | 3300042590 | Bacteria | 3229 |
| 24 | Ga0466691_063358 | 3300042593 | Bacteria | 23082 |
| 25 | Ga0466691_126007 | 3300042593 | Bacteria | 12051 |
| 26 | Ga0466691_223209 | 3300042593 | Bacteria | 41344 |
| 27 | Ga0466699_225574 | 3300042597 | Bacteria | 1102 |
| 28 | Ga0466729_301372 | 3300042621 | Bacteria | 1662 |
| 29 | Ga0466703_124512 | 3300042636 | Bacteria | 1742 |
| 30 | Ga0466704_062527 | 3300042643 | Bacteria | 10150 |
| 31 | Ga0466704_237508 | 3300042643 | Bacteria | 2784 |
| 32 | Ga0466704_254689 | 3300042643 | Unclassified | 6043 |
| 33 | Ga0466704_357422 | 3300042643 | Bacteria | 8136 |
| 34 | Ga0466704_601183 | 3300042643 | Bacteria | 2929 |
| 35 | JGI24698J34947_10002785 | 3300002449 | Bacteria | 9467 |
| 36 | JGI24695J34938_10014850 | 3300002450 | Bacteria | 4015 |
| 37 | JGI24695J34938_10022249 | 3300002450 | Bacteria | 3082 |
| 38 | Ga0466712_082259 | 3300042614 | Bacteria | 1936 |
| 39 | Ga0466711_129135 | 3300042615 | Bacteria | 31830 |
| 40 | Ga0466711_478569 | 3300042615 | Unclassified | 1213 |
| 41 | Ga0466715_310326 | 3300042616 | Bacteria | 12799 |
| 42 | Ga0466723_064070 | 3300042618 | Bacteria | 37236 |
| 43 | Ga0466726_382659 | 3300042619 | Bacteria | 18394 |
| 44 | Ga0466728_148598 | 3300042620 | Bacteria | 12482 |
| 45 | Ga0466728_184717 | 3300042620 | Bacteria | 25131 |
| 46 | Ga0466700_044787 | 3300042600 | Bacteria | 1262 |
| 47 | Ga0466719_357466 | 3300042606 | Bacteria | 2098 |
| 48 | Ga0466720_029629 | 3300042607 | Bacteria | 2659 |
| 49 | Ga0466722_025691 | 3300042609 | Bacteria | 6331 |
| 50 | Ga0466698_083508 | 3300042610 | Bacteria | 1900 |
| 51 | Ga0466693_329899 | 3300042592 | Bacteria | 8738 |
| 52 | Ga0466694_125385 | 3300042594 | Bacteria | 16030 |
| 53 | Ga0466696_149692 | 3300042596 | Bacteria | 17333 |
| 54 | Ga0466696_169065 | 3300042596 | Bacteria | 24365 |
| 55 | Ga0466699_348089 | 3300042597 | Bacteria | 1357 |
| 56 | Ga0466702_395552 | 3300042635 | Unclassified | 1310 |
| 57 | Ga0466703_029366 | 3300042636 | Bacteria | 7234 |
| 58 | Ga0466704_057415 | 3300042643 | Unclassified | 3176 |
| 59 | Ga0466704_167335 | 3300042643 | Bacteria | 2513 |
| 60 | Ga0466704_367248 | 3300042643 | Bacteria | 2834 |
| 61 | Ga0466708_014023 | 3300042652 | Bacteria | 3015 |
| 62 | Ga0466708_110302 | 3300042652 | Bacteria | 3247 |
| 63 | Ga0466727_279272 | 3300042655 | Bacteria | 4004 |
| 64 | AustNasuHG_c1003890 | 3300000089 | Bacteria | 5382 |
| 65 | JGI24695J34938_10005767 | 3300002450 | Bacteria | 7626 |
| 66 | Ga0072941_1016151 | 3300005201 | Unclassified | 2515 |
| 67 | Ga0466705_456004 | 3300042612 | Bacteria | 1207 |
| 68 | Ga0466712_102739 | 3300042614 | Bacteria | 2654 |
| 69 | Ga0466712_232545 | 3300042614 | Bacteria | 2283 |
| 70 | Ga0466711_336225 | 3300042615 | Bacteria | 4982 |
| 71 | Ga0466715_586843 | 3300042616 | Bacteria | 2225 |
| 72 | Ga0466715_611919 | 3300042616 | Bacteria | 1898 |
| 73 | Ga0466723_114237 | 3300042618 | Bacteria | 3934 |
| 74 | Ga0466726_321716 | 3300042619 | Bacteria | 2403 |
| 75 | Ga0466707_283605 | 3300042601 | Bacteria | 4076 |
| 76 | Ga0466719_258543 | 3300042606 | Unclassified | 2768 |
| 77 | Ga0466720_052575 | 3300042607 | Bacteria | 3122 |
| 78 | Ga0466722_009932 | 3300042609 | Bacteria | 19464 |
| 79 | Ga0466722_125399 | 3300042609 | Bacteria | 1105 |
| 80 | Ga0456237_0025865 | 3300041968 | Unclassified | 798 |
| 81 | Ga0466690_026067 | 3300042590 | Bacteria | 36637 |
| 82 | Ga0466690_368958 | 3300042590 | Bacteria | 10065 |
| 83 | Ga0466692_101573 | 3300042591 | Bacteria | 1719 |
| 84 | Ga0466691_144927 | 3300042593 | Bacteria | 4825 |
| 85 | Ga0466694_019833 | 3300042594 | Bacteria | 5085 |
| 86 | Ga0466699_030102 | 3300042597 | Bacteria | 1062 |
| 87 | Ga0466699_103795 | 3300042597 | Unclassified | 1236 |
| 88 | Ga0466732_115455 | 3300042656 | Bacteria | 18016 |
| 89 | Ga0466732_332314 | 3300042656 | Unclassified | 1092 |
| 90 | Ga0466735_134966 | 3300042624 | Bacteria | 2372 |
| 91 | Ga0466702_269540 | 3300042635 | Unclassified | 1425 |
| 92 | Ga0466703_074928 | 3300042636 | Bacteria | 7448 |
| 93 | Ga0466703_340982 | 3300042636 | Bacteria | 4771 |
| 94 | Ga0466704_087126 | 3300042643 | Unclassified | 5904 |
| 95 | Ga0466709_233371 | 3300042648 | Bacteria | 3486 |
| 96 | Ga0466708_285711 | 3300042652 | Bacteria | 7037 |
| 97 | Ga0466708_332665 | 3300042652 | Bacteria | 4434 |
| 98 | Ga0466727_162524 | 3300042655 | Unclassified | 1128 |
| 99 | JGI24698J34947_10039001 | 3300002449 | Bacteria | 2461 |
| 100 | JGI24695J34938_10092888 | 3300002450 | Bacteria | 1237 |
| 101 | Ga0466711_210986 | 3300042615 | Bacteria | 1569 |
| 102 | Ga0466715_239289 | 3300042616 | Bacteria | 2529 |
| 103 | Ga0466723_237404 | 3300042618 | Bacteria | 2813 |
| 104 | Ga0466726_400291 | 3300042619 | Bacteria | 1617 |
| 105 | Ga0466707_229999 | 3300042601 | Bacteria | 1221 |
| 106 | Ga0466707_270863 | 3300042601 | Bacteria | 1362 |
| 107 | Ga0466719_309753 | 3300042606 | Bacteria | 8277 |
| 108 | Ga0466719_495967 | 3300042606 | Bacteria | 34420 |
| 109 | Ga0466722_046520 | 3300042609 | Bacteria | 7615 |
| 110 | Ga0466690_023279 | 3300042590 | Bacteria | 5694 |
| 111 | Ga0466690_178087 | 3300042590 | Bacteria | 3469 |
| 112 | Ga0466691_177723 | 3300042593 | Bacteria | 22720 |
| 113 | Ga0466705_202934 | 3300042612 | Bacteria | 22495 |
| 114 | Ga0466732_229683 | 3300042656 | Bacteria | 2891 |
| 115 | Ga0123353_10464883 | 3300010167 | Bacteria | 1857 |
| 116 | Ga0466703_212671 | 3300042636 | Bacteria | 2020 |
| 117 | Ga0466704_129323 | 3300042643 | Bacteria | 30783 |
| 118 | Ga0466704_217833 | 3300042643 | Bacteria | 3110 |
| 119 | Ga0466704_274698 | 3300042643 | Bacteria | 3009 |
| 120 | Ga0466704_333404 | 3300042643 | Bacteria | 8010 |
| 121 | Ga0466709_208261 | 3300042648 | Bacteria | 5589 |
| 122 | Ga0466708_103694 | 3300042652 | Bacteria | 8665 |
| 123 | Ga0466708_111105 | 3300042652 | Bacteria | 10055 |
| 124 | Ga0466708_262169 | 3300042652 | Bacteria | 29232 |
| 125 | Ga0466727_019421 | 3300042655 | Bacteria | 1389 |
| 126 | Ga0466727_262353 | 3300042655 | Bacteria | 2885 |
| 127 | JGI24698J34947_10036065 | 3300002449 | Bacteria | 2577 |
| 128 | Ga0072941_1045532 | 3300005201 | Bacteria | 9325 |
| 129 | Ga0072941_1045629 | 3300005201 | Bacteria | 3747 |
| 130 | Ga0466705_479055 | 3300042612 | Bacteria | 2751 |
| 131 | Ga0466718_046298 | 3300042617 | Bacteria | 49319 |
| 132 | Ga0466723_104280 | 3300042618 | Bacteria | 10579 |
| 133 | Ga0466726_105550 | 3300042619 | Bacteria | 4208 |
| 134 | Ga0466726_459355 | 3300042619 | Bacteria | 2324 |
| 135 | Ga0466716_075709 | 3300042605 | Bacteria | 1497 |
| 136 | Ga0222431_1022460 | 3300021190 | Bacteria | 1249 |
| 137 | Ga0466690_275336 | 3300042590 | Bacteria | 10619 |
| 138 | Ga0466692_193949 | 3300042591 | Bacteria | 3403 |
| 139 | Ga0466696_353160 | 3300042596 | Bacteria | 10012 |
| 140 | Ga0466696_391456 | 3300042596 | Bacteria | 2971 |
| 141 | Ga0466705_125377 | 3300042612 | Bacteria | 2032 |
| 142 | Ga0466705_218182 | 3300042612 | Bacteria | 8067 |
| 143 | Ga0466705_349157 | 3300042612 | Unclassified | 9313 |
| 144 | Ga0466732_185257 | 3300042656 | Bacteria | 7874 |
| 145 | Ga0123353_10343492 | 3300010167 | Bacteria | 2253 |
| 146 | Ga0123353_10866094 | 3300010167 | Bacteria | 1236 |
| 147 | Ga0466702_100321 | 3300042635 | Bacteria | 2810 |
| 148 | Ga0466703_006152 | 3300042636 | Bacteria | 4910 |
| 149 | Ga0466703_066761 | 3300042636 | Bacteria | 16921 |
| 150 | Ga0466703_100138 | 3300042636 | Bacteria | 36780 |
| 151 | Ga0466703_330108 | 3300042636 | Bacteria | 33404 |
| 152 | Ga0466704_216757 | 3300042643 | Bacteria | 32252 |
| 153 | Ga0466704_320393 | 3300042643 | Bacteria | 5112 |
| 154 | Ga0466709_083805 | 3300042648 | Bacteria | 22572 |
| 155 | Ga0466709_087227 | 3300042648 | Bacteria | 37592 |
| 156 | Ga0466708_144856 | 3300042652 | Bacteria | 5737 |
| 157 | Ga0466727_324604 | 3300042655 | Bacteria | 1282 |
| 158 | Ga0466705_399293 | 3300042612 | Bacteria | 3059 |
| 159 | Ga0466712_025312 | 3300042614 | Bacteria | 8909 |
| 160 | Ga0466712_242397 | 3300042614 | Bacteria | 5150 |
| 161 | Ga0466711_095567 | 3300042615 | Bacteria | 18412 |
| 162 | Ga0466711_099015 | 3300042615 | Bacteria | 17568 |
| 163 | Ga0466715_112871 | 3300042616 | Bacteria | 8877 |
| 164 | Ga0466723_008126 | 3300042618 | Bacteria | 4887 |
| 165 | Ga0466723_013333 | 3300042618 | Bacteria | 24235 |
| 166 | Ga0466723_168164 | 3300042618 | Bacteria | 1157 |
| 167 | Ga0466723_249451 | 3300042618 | Bacteria | 1582 |
| 168 | Ga0466726_028495 | 3300042619 | Bacteria | 2489 |
| 169 | Ga0466728_090952 | 3300042620 | Bacteria | 2717 |
| 170 | Ga0466728_155499 | 3300042620 | Bacteria | 3144 |
| 171 | Ga0466706_230268 | 3300042599 | Bacteria | 3448 |
| 172 | Ga0466707_361165 | 3300042601 | Bacteria | 1375 |
| 173 | Ga0466716_196140 | 3300042605 | Bacteria | 29327 |
| 174 | Ga0466716_290291 | 3300042605 | Bacteria | 8816 |
| 175 | Ga0466696_043616 | 3300042596 | Bacteria | 14161 |
| 176 | Ga0466696_241750 | 3300042596 | Bacteria | 6414 |
| 177 | Ga0466705_175790 | 3300042612 | Bacteria | 2981 |
| 178 | Ga0466705_277892 | 3300042612 | Bacteria | 6667 |
| 179 | Ga0466705_286435 | 3300042612 | Unclassified | 3326 |
| 180 | Ga0466703_341913 | 3300042636 | Bacteria | 13824 |
| 181 | Ga0466704_021674 | 3300042643 | Bacteria | 2805 |
| 182 | Ga0466704_176057 | 3300042643 | Bacteria | 3478 |
| 183 | Ga0466708_008424 | 3300042652 | Bacteria | 4761 |
| 184 | Ga0466708_259687 | 3300042652 | Bacteria | 6356 |
| 185 | Ga0068302_10201837 | 3300005071 | Bacteria | 1593 |
| 186 | Ga0466715_017111 | 3300042616 | Bacteria | 2250 |
| 187 | Ga0466715_055001 | 3300042616 | Bacteria | 1411 |
| 188 | Ga0466723_113378 | 3300042618 | Bacteria | 18406 |
| 189 | Ga0466726_137202 | 3300042619 | Bacteria | 1178 |
| 190 | Ga0466726_402501 | 3300042619 | Bacteria | 3284 |
| 191 | Ga0466707_166365 | 3300042601 | Bacteria | 1600 |
| 192 | Ga0466716_159624 | 3300042605 | Bacteria | 15667 |
| 193 | Ga0466720_106846 | 3300042607 | Bacteria | 7299 |
| 194 | Ga0264413_140284 | 3300024493 | Bacteria | 2090 |
| 195 | Ga0466696_421546 | 3300042596 | Bacteria | 28748 |
| 196 | Ga0466699_148455 | 3300042597 | Bacteria | 1474 |
| 197 | Ga0466705_315035 | 3300042612 | Bacteria | 13878 |
| 198 | Ga0466703_044738 | 3300042636 | Bacteria | 12308 |
| 199 | Ga0466703_409388 | 3300042636 | Bacteria | 18630 |
| 200 | Ga0466709_188885 | 3300042648 | Bacteria | 4626 |
| 201 | Ga0466727_143324 | 3300042655 | Bacteria | 2016 |
| 202 | Ga0072941_1011983 | 3300005201 | Bacteria | 17698 |
| 203 | Ga0072941_1038006 | 3300005201 | Bacteria | 2113 |
| 204 | Ga0466726_335483 | 3300042619 | Bacteria | 23284 |
| 205 | Ga0466713_007529 | 3300042602 | Bacteria | 1155 |
| 206 | Ga0466720_124190 | 3300042607 | Bacteria | 11201 |
| 207 | Ga0466690_063188 | 3300042590 | Bacteria | 5560 |
| 208 | Ga0466690_406035 | 3300042590 | Bacteria | 2242 |
| 209 | Ga0466692_029076 | 3300042591 | Bacteria | 6474 |
| 210 | Ga0466691_198792 | 3300042593 | Bacteria | 1171 |
| 211 | Ga0466696_045007 | 3300042596 | Bacteria | 13818 |
| 212 | Ga0466696_199989 | 3300042596 | Bacteria | 4543 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.