Protein Family IF04962

Metagenome Isolate
120 Members
35 Samples
110 Scaffolds
282.57 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_007078|Ga0466694_007078_10614_11552
Length
305 aa
Sequence
LWISVRLQWFLALFLSYEGGKMKKLISGKVREVYDILSSSDDKLVIVTTDRISAFDVILSKLVKDKGKVLNAVSLFWFDFTKDIIPNHIISSDLKDMPEFFRKSEFEGRTVLVKKLKMLPFEFIVRGYMFGTMWNAYSKGEEFCGQKIEGDYKQAEKLAAPLFTPSTKAHTGHDEYISIKYLADTIGGELAKKIEKICFEIYNTCYNYAYNKNIIIADTKFEFGLDENNNLFLADEVLTPDSSRFWSLSDYQAGTSPKSYDKQFVRDWLLNNKKDGQMQFDNVPDDILNKTSDIYAECLRKLVNA

πŸ“Š Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.4%
Termitidae 33.3%
Formicidae 12.1%
Rhinotermitidae 6.1%
Kalotermitidae 6.1%
Termopsidae 3.0%
Passalidae 3.0%

🌳 Taxonomy

Archaea 2
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
2 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
3 2772190998 Unclassified Bathyarchaeota Nc150P4bin1 Isolate Unclassified
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
7 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
8 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
13 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
19 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
20 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
26 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
27 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
28 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_120335 3300042601 Bacteria 23353
2 Ga0466713_092919 3300042602 Bacteria 77366
3 Ga0466698_037473 3300042610 Bacteria 1454
4 Ga0466699_012069 3300042597 Bacteria 1261
5 Ga0466699_380399 3300042597 Bacteria 3795
6 AustNasuHG_c1018005 3300000089 Bacteria 2337
7 Ga0072941_1135479 3300005201 Bacteria 6313
8 Ga0074263_109979 3300005485 Bacteria 3977
9 Ga0102735_1000083 3300007080 Bacteria 25246
10 Ga0103267_1000013 3300007190 Bacteria 65512
11 Ga0103268_1000031 3300007192 Bacteria 45121
12 Ga0466702_101429 3300042635 Bacteria 1752
13 Ga0466718_121542 3300042617 Bacteria 3688
14 Ga0466719_076092 3300042606 Bacteria 1865
15 Ga0466720_068653 3300042607 Bacteria 4107
16 Ga0466720_142302 3300042607 Bacteria 1394
17 Ga0123353_10083741 3300010167 Bacteria 5133
18 Ga0466694_126938 3300042594 Bacteria 17529
19 Ga0466699_115075 3300042597 Bacteria 5036
20 Ga0466699_437116 3300042597 Bacteria 20035
21 IMNBL1DRAFT_c0003588 3300000062 Bacteria 9843
22 AustNasuHG_c1022899 3300000089 Bacteria 2001
23 Ga0074263_111705 3300005485 Bacteria 4126
24 Ga0103264_1000018 3300007188 Bacteria 128388
25 Ga0466702_168211 3300042635 Bacteria 6442
26 Ga0466718_126141 3300042617 Bacteria 3659
27 Ga0466732_195138 3300042656 Bacteria 15041
28 Ga0466732_255003 3300042656 Archaea 12212
29 Ga0466732_379577 3300042656 Bacteria 21224
30 Ga0466707_022985 3300042601 Bacteria 35285
31 Ga0466720_018922 3300042607 Bacteria 1822
32 Ga0466720_031665 3300042607 Bacteria 3576
33 Ga0466720_130191 3300042607 Bacteria 3597
34 Ga0466722_257644 3300042609 Bacteria 49245
35 Ga0466698_087926 3300042610 Bacteria 1415
36 Ga0466699_008755 3300042597 Bacteria 1541
37 Ga0466699_147286 3300042597 Bacteria 2183
38 Ga0466699_150208 3300042597 Bacteria 1837
39 Ga0466699_169300 3300042597 Bacteria 1034
40 Ga0466699_190241 3300042597 Bacteria 9619
41 AustNasuHG_c1006232 3300000089 Bacteria 4261
42 Ga0466718_050586 3300042617 Bacteria 10484
43 Ga0466718_055454 3300042617 Bacteria 1422
44 Ga0466732_398176 3300042656 Bacteria 2432
45 Ga0466707_277519 3300042601 Bacteria 2502
46 Ga0466720_117769 3300042607 Unclassified 2297
47 Ga0466699_134127 3300042597 Unclassified 1102
48 Ga0466699_255253 3300042597 Bacteria 8964
49 AustNasuHG_c1005096 3300000089 Bacteria 4699
50 AustNasuHG_c1005661 3300000089 Bacteria 4472
51 Ga0466704_094551 3300042643 Bacteria 3155
52 Ga0466718_000478 3300042617 Bacteria 1985
53 Ga0466718_034957 3300042617 Bacteria 3930
54 Ga0466718_120957 3300042617 Bacteria 20111
55 Ga0466720_020803 3300042607 Bacteria 5579
56 Ga0466720_066729 3300042607 Bacteria 10048
57 Ga0466720_112162 3300042607 Bacteria 1836
58 Ga0466720_171391 3300042607 Bacteria 8056
59 Ga0264413_120098 3300024493 Bacteria 2222
60 Ga0466694_352061 3300042594 Bacteria 4721
61 Ga0466699_131531 3300042597 Bacteria 20480
62 Ga0466699_152157 3300042597 Unclassified 1004
63 AustNasuHG_c1001742 3300000089 Bacteria 7867
64 JGI24695J34938_10021532 3300002450 Bacteria 3151
65 Ga0072941_1233634 3300005201 Bacteria 3115
66 Ga0074263_107779 3300005485 Bacteria 2773
67 Ga0074263_108470 3300005485 Bacteria 6240
68 Ga0466704_295958 3300042643 Bacteria 6529
69 Ga0466718_130509 3300042617 Bacteria 6822
70 Ga0466720_012731 3300042607 Bacteria 38091
71 Ga0466720_116740 3300042607 Bacteria 72912
72 Ga0466720_121956 3300042607 Bacteria 8223
73 Ga0466720_147033 3300042607 Bacteria 48792
74 Ga0466698_464446 3300042610 Bacteria 1426
75 Ga0264413_101684 3300024493 Bacteria 18599
76 Ga0466694_007078 3300042594 Bacteria 11801
77 Ga0466694_098932 3300042594 Unclassified 3162
78 Ga0466694_299537 3300042594 Bacteria 5778
79 Ga0466699_004283 3300042597 Bacteria 2692
80 Ga0466699_219759 3300042597 Bacteria 9600
81 IMNBL1DRAFT_c0003288 3300000062 Bacteria 10520
82 Ga0074263_108134 3300005485 Bacteria 5918
83 Ga0074263_117392 3300005485 Bacteria 2703
84 Ga0466702_164877 3300042635 Bacteria 1393
85 Ga0466702_323122 3300042635 Bacteria 1789
86 Ga0466718_033383 3300042617 Bacteria 3930
87 Ga0466718_083344 3300042617 Bacteria 41687
88 Ga0466729_017964 3300042621 Bacteria 95785
89 Ga0466698_452963 3300042610 Bacteria 1058
90 Ga0466694_244817 3300042594 Bacteria 21258
91 Ga0466699_154626 3300042597 Bacteria 2219
92 Ga0466699_160306 3300042597 Bacteria 14939
93 Ga0466699_256565 3300042597 Bacteria 1950
94 AustNasuHG_c1017962 3300000089 Bacteria 2340
95 JGI24695J34938_10006602 3300002450 Bacteria 6926
96 Ga0074263_111576 3300005485 Bacteria 1599
97 Ga0466702_244361 3300042635 Bacteria 5062
98 Ga0466704_440783 3300042643 Bacteria 4641
99 Ga0466727_001674 3300042655 Bacteria 26788
100 Ga0466718_034340 3300042617 Bacteria 1996
101 Ga0466720_054175 3300042607 Bacteria 2159
102 Ga0466720_061122 3300042607 Bacteria 8477
103 Ga0466694_222943 3300042594 Bacteria 1401
104 Ga0466699_002401 3300042597 Bacteria 74503
105 Ga0466699_008728 3300042597 Bacteria 1131
106 Ga0466699_154965 3300042597 Bacteria 12710
107 Ga0466699_441266 3300042597 Bacteria 28353
108 AustNasuHG_c1000286 3300000089 Bacteria 17498
109 AustNasuHG_c1010392 3300000089 Bacteria 3244
110 Ga0074263_111125 3300005485 Bacteria 2628

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01259 SAICAR_synt SAICAR synthetase 25 279 0.95

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.