Protein Family IF04938
Metagenome
Isolate
111
Members
44
Samples
105
Scaffolds
293.19
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_181114|Ga0466691_181114_2344_3288
- Length
- 314 aa
- Sequence
- MLNKEIITGKNIAPATGFDPHPTPTKIGIFGSDYQAGKQNAVRELFDRLKERHTEIWVEKQFYRYLSQTFAFTPDIAGQIDSETLPLDMVFSLGGDGTFLRTAAWVGRQPIPVLGFNTGNLGFLADVSAGEIQPTLDEIFRGEYRLEEKSLLQLETTEPLPYRHALNEIAVLKRDTASMIEVAATLNDEFLTEYRADGLLLSTPTGSTAYNLSVNGPIILPASKSFVLSPVAPHSLNMRPLVIPENYKIRLRVESRNKNFLISFDGRSAVFPTGSEFLIQKADFSLKVVKRLQQSFYNTLRKKLLWGTDTRSQN
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
27.9%
Unclassified
14.0%
Termopsidae
9.3%
Blattidae
7.0%
Passalidae
4.7%
Rhinotermitidae
4.7%
Taxonomy
Archaea
1
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 3 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 27 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10146736 | 3300010049 | Bacteria | 2335 |
| 2 | Ga0466705_501789 | 3300042612 | Unclassified | 1460 |
| 3 | Ga0466715_572331 | 3300042616 | Bacteria | 10909 |
| 4 | JGI24705J35276_12238552 | 3300002504 | Bacteria | 26267 |
| 5 | Ga0466713_040197 | 3300042602 | Bacteria | 1648 |
| 6 | Ga0466709_106711 | 3300042648 | Bacteria | 14160 |
| 7 | Ga0466725_054318 | 3300042654 | Bacteria | 16266 |
| 8 | Ga0466727_169454 | 3300042655 | Bacteria | 8118 |
| 9 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 10 | Ga0466712_277911 | 3300042614 | Bacteria | 1146 |
| 11 | IMNBL1DRAFT_c0000182 | 3300000062 | Bacteria | 55861 |
| 12 | JGI24702J35022_10006234 | 3300002462 | Bacteria | 6909 |
| 13 | Ga0072940_1286668 | 3300005200 | Bacteria | 1504 |
| 14 | Ga0466701_075893 | 3300042598 | Bacteria | 43978 |
| 15 | Ga0466707_030098 | 3300042601 | Bacteria | 1075 |
| 16 | Ga0466707_173612 | 3300042601 | Bacteria | 5617 |
| 17 | Ga0466713_042537 | 3300042602 | Bacteria | 19077 |
| 18 | Ga0466716_100304 | 3300042605 | Bacteria | 28707 |
| 19 | Ga0466716_165444 | 3300042605 | Bacteria | 8783 |
| 20 | Ga0466719_493982 | 3300042606 | Bacteria | 1143 |
| 21 | Ga0466703_019883 | 3300042636 | Bacteria | 23097 |
| 22 | Ga0466704_192304 | 3300042643 | Bacteria | 4511 |
| 23 | Ga0466704_328597 | 3300042643 | Bacteria | 18009 |
| 24 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 25 | Ga0123356_10196653 | 3300010049 | Bacteria | 2052 |
| 26 | Ga0123353_10119967 | 3300010167 | Bacteria | 4229 |
| 27 | Ga0466711_048383 | 3300042615 | Bacteria | 8361 |
| 28 | Ga0466715_269094 | 3300042616 | Bacteria | 6359 |
| 29 | 2227223883 | 2225789004 | Bacteria | 1381 |
| 30 | Ga0068305_10072648 | 3300005083 | Bacteria | 7795 |
| 31 | Ga0466722_139997 | 3300042609 | Bacteria | 1229 |
| 32 | Ga0466735_029179 | 3300042624 | Bacteria | 8983 |
| 33 | Ga0466708_093039 | 3300042652 | Bacteria | 3751 |
| 34 | Ga0466708_299612 | 3300042652 | Bacteria | 12375 |
| 35 | Ga0466727_204579 | 3300042655 | Bacteria | 3025 |
| 36 | Ga0123356_10626223 | 3300010049 | Bacteria | 1242 |
| 37 | Ga0466705_064108 | 3300042612 | Bacteria | 27405 |
| 38 | Ga0466733_101223 | 3300042659 | Bacteria | 57262 |
| 39 | IMNBL1DRAFT_c0001576 | 3300000062 | Bacteria | 16969 |
| 40 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 41 | Ga0068305_10011748 | 3300005083 | Unclassified | 10955 |
| 42 | Ga0068305_10177511 | 3300005083 | Bacteria | 10537 |
| 43 | Ga0466719_039323 | 3300042606 | Bacteria | 17178 |
| 44 | Ga0466704_497510 | 3300042643 | Bacteria | 27766 |
| 45 | Ga0466690_395845 | 3300042590 | Bacteria | 33359 |
| 46 | Ga0466696_295695 | 3300042596 | Bacteria | 13583 |
| 47 | Ga0123356_10538962 | 3300010049 | Bacteria | 1327 |
| 48 | Ga0466705_086320 | 3300042612 | Bacteria | 10935 |
| 49 | Ga0466715_239461 | 3300042616 | Bacteria | 4791 |
| 50 | Ga0466723_094398 | 3300042618 | Bacteria | 5285 |
| 51 | Ga0466723_178619 | 3300042618 | Bacteria | 21638 |
| 52 | Ga0466703_188748 | 3300042636 | Bacteria | 3653 |
| 53 | Ga0466703_258779 | 3300042636 | Bacteria | 8049 |
| 54 | Ga0466709_128488 | 3300042648 | Bacteria | 12684 |
| 55 | Ga0466690_165241 | 3300042590 | Bacteria | 9329 |
| 56 | Ga0466691_181114 | 3300042593 | Bacteria | 3925 |
| 57 | Ga0466691_206071 | 3300042593 | Bacteria | 26570 |
| 58 | Ga0466696_196899 | 3300042596 | Archaea | 5084 |
| 59 | Ga0123353_10573024 | 3300010167 | Bacteria | 1622 |
| 60 | Ga0466728_183708 | 3300042620 | Bacteria | 10319 |
| 61 | Ga0466707_410055 | 3300042601 | Bacteria | 2587 |
| 62 | Ga0466719_062848 | 3300042606 | Bacteria | 11457 |
| 63 | Ga0466722_044078 | 3300042609 | Bacteria | 11030 |
| 64 | Ga0466735_221968 | 3300042624 | Bacteria | 5109 |
| 65 | Ga0466703_021232 | 3300042636 | Bacteria | 5237 |
| 66 | Ga0466704_391716 | 3300042643 | Bacteria | 3684 |
| 67 | Ga0466704_413829 | 3300042643 | Bacteria | 8510 |
| 68 | Ga0466709_216670 | 3300042648 | Bacteria | 31600 |
| 69 | Ga0466696_257847 | 3300042596 | Bacteria | 2244 |
| 70 | Ga0466723_205264 | 3300042618 | Unclassified | 5427 |
| 71 | Ga0068302_10129354 | 3300005071 | Bacteria | 6256 |
| 72 | Ga0466701_040830 | 3300042598 | Bacteria | 2723 |
| 73 | Ga0466700_056215 | 3300042600 | Bacteria | 2238 |
| 74 | Ga0466707_039907 | 3300042601 | Bacteria | 5174 |
| 75 | Ga0466707_161945 | 3300042601 | Bacteria | 21911 |
| 76 | Ga0466707_298996 | 3300042601 | Bacteria | 2274 |
| 77 | Ga0466713_023492 | 3300042602 | Bacteria | 12031 |
| 78 | Ga0466713_035414 | 3300042602 | Bacteria | 3797 |
| 79 | Ga0466713_124643 | 3300042602 | Bacteria | 27149 |
| 80 | Ga0466735_184330 | 3300042624 | Bacteria | 3156 |
| 81 | Ga0466703_225656 | 3300042636 | Bacteria | 7297 |
| 82 | Ga0466708_460639 | 3300042652 | Bacteria | 18491 |
| 83 | Ga0466727_137368 | 3300042655 | Bacteria | 15897 |
| 84 | Ga0466656_086426 | 3300042550 | Bacteria | 17058 |
| 85 | Ga0123353_10472936 | 3300010167 | Bacteria | 1837 |
| 86 | Ga0466715_218422 | 3300042616 | Bacteria | 20789 |
| 87 | Ga0466723_142424 | 3300042618 | Bacteria | 10936 |
| 88 | Ga0466726_026792 | 3300042619 | Bacteria | 7721 |
| 89 | Ga0466728_053723 | 3300042620 | Bacteria | 3647 |
| 90 | JGI24702J35022_10000587 | 3300002462 | Bacteria | 22066 |
| 91 | JGI24702J35022_10042431 | 3300002462 | Bacteria | 2423 |
| 92 | JGI24702J35022_10059107 | 3300002462 | Bacteria | 2048 |
| 93 | Ga0072941_1096908 | 3300005201 | Bacteria | 6905 |
| 94 | Ga0466716_092980 | 3300042605 | Bacteria | 25359 |
| 95 | Ga0466719_138260 | 3300042606 | Bacteria | 4681 |
| 96 | Ga0466735_116663 | 3300042624 | Bacteria | 17397 |
| 97 | Ga0466703_162080 | 3300042636 | Bacteria | 6824 |
| 98 | Ga0466704_171257 | 3300042643 | Bacteria | 13166 |
| 99 | Ga0466709_116198 | 3300042648 | Bacteria | 9234 |
| 100 | Ga0466708_071605 | 3300042652 | Bacteria | 10063 |
| 101 | Ga0466725_025030 | 3300042654 | Bacteria | 16813 |
| 102 | Ga0466727_157093 | 3300042655 | Bacteria | 11119 |
| 103 | Ga0466727_221985 | 3300042655 | Bacteria | 7289 |
| 104 | Ga0466690_410975 | 3300042590 | Bacteria | 5454 |
| 105 | Ga0466692_052308 | 3300042591 | Unclassified | 1975 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.