Protein Family IF04929
Metagenome
Isolate
136
Members
58
Samples
126
Scaffolds
311.65
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_162398|Ga0466691_162398_227_1273
- Length
- 348 aa
- Sequence
- VVLDWVPKTTPQDTASREPYRHDDKGWIFVSKRKLLSIVVPTYNEELNVVPLSKAIVCEIEKSLPQYDYEIIFIDNFSIDHTRALIADICRINKKIKAIFNARNFGAVNSGVYGLCQSTGDCTILLNADFQDPIEMIPVLVKEWENGYKIVSAIKTTSKENKFVRFLRTCYYKLIRKMSEDVEQIEHFTGFGLYDKEFIDVLRQLDDSQPFLRGIVAELGPRRKDIPYQQQKRRAGKSTYNWYRYYDIAMLGFTSYTKIGMRLATILGFIISLCSIAIGLVYLVLKLTNWDAFPTGSAPILIGVFVLGGLQIFFIGLAGEYILNINSRIMKRPLVVEERRINFDEPSP
Sample Types
Isolate
7.3%
Metagenome
92.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.3%
Kalotermitidae
25.0%
Unclassified
14.3%
Blattidae
7.1%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
1
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 28 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 48 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 53 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10000180 | 3300009826 | Bacteria | 77979 |
| 2 | Ga0123356_10002210 | 3300010049 | Bacteria | 20938 |
| 3 | Ga0466735_097045 | 3300042624 | Bacteria | 9135 |
| 4 | Ga0466702_048759 | 3300042635 | Bacteria | 1841 |
| 5 | Ga0466708_290632 | 3300042652 | Bacteria | 5775 |
| 6 | Ga0466723_091106 | 3300042618 | Bacteria | 2468 |
| 7 | Ga0466723_185666 | 3300042618 | Bacteria | 15931 |
| 8 | Ga0466728_046183 | 3300042620 | Bacteria | 22842 |
| 9 | Ga0466706_287910 | 3300042599 | Bacteria | 14097 |
| 10 | Ga0466719_186636 | 3300042606 | Bacteria | 2058 |
| 11 | Ga0415639_183290 | 3300038395 | Bacteria | 3159 |
| 12 | Ga0466690_163291 | 3300042590 | Bacteria | 7579 |
| 13 | Ga0466699_152973 | 3300042597 | Bacteria | 7288 |
| 14 | Ga0123355_10000666 | 3300009826 | Bacteria | 46536 |
| 15 | Ga0123355_10006641 | 3300009826 | Bacteria | 17181 |
| 16 | Ga0123356_10034023 | 3300010049 | Bacteria | 4766 |
| 17 | Ga0123356_10046240 | 3300010049 | Bacteria | 4049 |
| 18 | Ga0123356_10173598 | 3300010049 | Bacteria | 2169 |
| 19 | Ga0123356_10521731 | 3300010049 | Bacteria | 1346 |
| 20 | AustNasuHG_c1008466 | 3300000089 | Unclassified | 3638 |
| 21 | Ga0068302_10520043 | 3300005071 | Unclassified | 1628 |
| 22 | Ga0466731_411674 | 3300042622 | Bacteria | 5182 |
| 23 | Ga0466702_432230 | 3300042635 | Bacteria | 3193 |
| 24 | Ga0466703_146085 | 3300042636 | Bacteria | 2600 |
| 25 | Ga0466704_269891 | 3300042643 | Bacteria | 69200 |
| 26 | Ga0466711_440895 | 3300042615 | Bacteria | 2285 |
| 27 | Ga0466718_091988 | 3300042617 | Unclassified | 10107 |
| 28 | Ga0466726_151452 | 3300042619 | Bacteria | 1474 |
| 29 | Ga0466728_104057 | 3300042620 | Bacteria | 17641 |
| 30 | Ga0466706_052327 | 3300042599 | Bacteria | 8254 |
| 31 | Ga0466720_018719 | 3300042607 | Unclassified | 3001 |
| 32 | Ga0466722_021301 | 3300042609 | Bacteria | 6222 |
| 33 | Ga0264413_129263 | 3300024493 | Bacteria | 13573 |
| 34 | Ga0264413_135732 | 3300024493 | Bacteria | 3405 |
| 35 | Ga0466696_031063 | 3300042596 | Bacteria | 1043 |
| 36 | Ga0068305_10155159 | 3300005083 | Bacteria | 1867 |
| 37 | Ga0466729_202269 | 3300042621 | Bacteria | 4611 |
| 38 | Ga0466729_311769 | 3300042621 | Unclassified | 2319 |
| 39 | Ga0466730_068103 | 3300042625 | Bacteria | 7335 |
| 40 | Ga0466702_274631 | 3300042635 | Bacteria | 1708 |
| 41 | Ga0466704_290361 | 3300042643 | Bacteria | 3983 |
| 42 | Ga0466711_410792 | 3300042615 | Unclassified | 5254 |
| 43 | Ga0466706_131732 | 3300042599 | Bacteria | 1433 |
| 44 | Ga0466705_322723 | 3300042612 | Bacteria | 9646 |
| 45 | Ga0466732_194882 | 3300042656 | Unclassified | 1711 |
| 46 | Ga0466696_045345 | 3300042596 | Bacteria | 5640 |
| 47 | Ga0123353_10000329 | 3300010167 | Bacteria | 58569 |
| 48 | JGI24698J34947_10002059 | 3300002449 | Bacteria | 10746 |
| 49 | JGI24698J34947_10015784 | 3300002449 | Bacteria | 4108 |
| 50 | Ga0068305_10007844 | 3300005083 | Bacteria | 14505 |
| 51 | Ga0072941_1176014 | 3300005201 | Bacteria | 3343 |
| 52 | Ga0466708_104150 | 3300042652 | Bacteria | 29160 |
| 53 | Ga0466715_370575 | 3300042616 | Bacteria | 24804 |
| 54 | Ga0466718_075881 | 3300042617 | Bacteria | 13965 |
| 55 | Ga0466713_029009 | 3300042602 | Bacteria | 31538 |
| 56 | Ga0466732_331438 | 3300042656 | Bacteria | 28230 |
| 57 | Ga0466690_133899 | 3300042590 | Bacteria | 17989 |
| 58 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 59 | Ga0123356_10344171 | 3300010049 | Bacteria | 1613 |
| 60 | Ga0123353_10214693 | 3300010167 | Bacteria | 3014 |
| 61 | Ga0466731_048131 | 3300042622 | Bacteria | 17747 |
| 62 | Ga0466702_396121 | 3300042635 | Bacteria | 1400 |
| 63 | Ga0466703_027689 | 3300042636 | Bacteria | 31024 |
| 64 | Ga0466704_018797 | 3300042643 | Bacteria | 55333 |
| 65 | Ga0466704_204091 | 3300042643 | Bacteria | 16068 |
| 66 | Ga0466705_416322 | 3300042612 | Bacteria | 2185 |
| 67 | Ga0466712_022395 | 3300042614 | Unclassified | 2107 |
| 68 | Ga0466728_046477 | 3300042620 | Bacteria | 4632 |
| 69 | Ga0466728_066222 | 3300042620 | Bacteria | 9733 |
| 70 | Ga0466706_115591 | 3300042599 | Bacteria | 30125 |
| 71 | Ga0466706_231754 | 3300042599 | Bacteria | 9520 |
| 72 | Ga0466716_297253 | 3300042605 | Bacteria | 2983 |
| 73 | Ga0466721_035301 | 3300042608 | Bacteria | 11030 |
| 74 | Ga0466705_295862 | 3300042612 | Bacteria | 10981 |
| 75 | Ga0466733_017424 | 3300042659 | Bacteria | 26015 |
| 76 | Ga0466733_205813 | 3300042659 | Bacteria | 3348 |
| 77 | Ga0466690_411935 | 3300042590 | Bacteria | 19362 |
| 78 | Ga0466691_162398 | 3300042593 | Bacteria | 9269 |
| 79 | Ga0123355_10109331 | 3300009826 | Bacteria | 4324 |
| 80 | Ga0123353_10002433 | 3300010167 | Bacteria | 23134 |
| 81 | 2227166925 | 2225789004 | Bacteria | 8292 |
| 82 | AustNasuHG_c1011736 | 3300000089 | Bacteria | 3034 |
| 83 | JGI24698J34947_10007689 | 3300002449 | Bacteria | 5920 |
| 84 | JGI24695J34938_10003444 | 3300002450 | Bacteria | 11048 |
| 85 | JGI24699J35502_11102889 | 3300002509 | Bacteria | 2417 |
| 86 | Ga0068305_10002964 | 3300005083 | Bacteria | 33952 |
| 87 | Ga0466715_207234 | 3300042616 | Bacteria | 35424 |
| 88 | Ga0466715_505560 | 3300042616 | Bacteria | 2342 |
| 89 | Ga0466722_212251 | 3300042609 | Bacteria | 9267 |
| 90 | Ga0466705_206629 | 3300042612 | Bacteria | 11905 |
| 91 | Ga0466692_199822 | 3300042591 | Unclassified | 12610 |
| 92 | Ga0466699_163112 | 3300042597 | Bacteria | 3805 |
| 93 | Ga0123356_10056174 | 3300010049 | Bacteria | 3667 |
| 94 | 2227461363 | 2225789004 | Bacteria | 5349 |
| 95 | 2227507959 | 2225789004 | Bacteria | 65570 |
| 96 | AustNasuHG_c1002796 | 3300000089 | Bacteria | 6306 |
| 97 | JGI24698J34947_10034786 | 3300002449 | Unclassified | 2634 |
| 98 | Ga0466731_375346 | 3300042622 | Bacteria | 3140 |
| 99 | Ga0466735_086755 | 3300042624 | Bacteria | 3724 |
| 100 | Ga0466703_152245 | 3300042636 | Bacteria | 7029 |
| 101 | Ga0466704_538691 | 3300042643 | Bacteria | 2179 |
| 102 | Ga0466709_415858 | 3300042648 | Bacteria | 3788 |
| 103 | Ga0466715_078593 | 3300042616 | Bacteria | 1589 |
| 104 | Ga0466723_154928 | 3300042618 | Bacteria | 7721 |
| 105 | Ga0466720_022415 | 3300042607 | Bacteria | 22736 |
| 106 | Ga0466699_046742 | 3300042597 | Unclassified | 15155 |
| 107 | Ga0123355_10000018 | 3300009826 | Bacteria | 155505 |
| 108 | Ga0123355_10014679 | 3300009826 | Bacteria | 12264 |
| 109 | Ga0123355_10164479 | 3300009826 | Bacteria | 3333 |
| 110 | Ga0123355_10652697 | 3300009826 | Bacteria | 1227 |
| 111 | Ga0123356_10037122 | 3300010049 | Unclassified | 4547 |
| 112 | Ga0123353_10174790 | 3300010167 | Bacteria | 3406 |
| 113 | JGI24702J35022_10021116 | 3300002462 | Bacteria | 3533 |
| 114 | JGI24696J40584_12961154 | 3300002834 | Bacteria | 11386 |
| 115 | Ga0072940_1294824 | 3300005200 | Archaea | 1568 |
| 116 | Ga0072941_1047344 | 3300005201 | Bacteria | 5191 |
| 117 | Ga0466703_224451 | 3300042636 | Bacteria | 6068 |
| 118 | Ga0466703_353112 | 3300042636 | Bacteria | 2185 |
| 119 | Ga0466704_560172 | 3300042643 | Bacteria | 2199 |
| 120 | Ga0466709_116551 | 3300042648 | Bacteria | 44112 |
| 121 | Ga0466723_071847 | 3300042618 | Bacteria | 22986 |
| 122 | Ga0466728_298652 | 3300042620 | Bacteria | 3085 |
| 123 | Ga0466706_065494 | 3300042599 | Bacteria | 27814 |
| 124 | Ga0466700_132237 | 3300042600 | Bacteria | 1464 |
| 125 | Ga0466713_095358 | 3300042602 | Bacteria | 22885 |
| 126 | Ga0466713_124947 | 3300042602 | Bacteria | 1782 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00535 | Glycos_transf_2 | Glycosyl transferase family 2 | 37 | 187 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.