Protein Family IF04917
Metagenome
Isolate
180
Members
53
Samples
175
Scaffolds
178.26
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_135882|Ga0466691_135882_4993_5550
- Length
- 171 aa
- Sequence
- MKKTEIRSTTVLAVRKGETVMKNNARKVRRLMDGKVLCGFAGATADAFTLFDLFEVKLKEYSGDLLRAAVELAKEWRTDRTLRRLEALLLVADLQKTLLISGTGDVIEPAEDALAIGSVGNYAYAAALAYLEGSAFSAAEIAEKSLKIAGNICIYTNSQIMLEELPSKEKK
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Kalotermitidae
25.5%
Unclassified
11.8%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10901800 | 3300010049 | Bacteria | 1055 |
| 2 | Ga0123354_10193484 | 3300010882 | Bacteria | 2267 |
| 3 | Ga0466712_056807 | 3300042614 | Bacteria | 31023 |
| 4 | Ga0466711_133683 | 3300042615 | Bacteria | 7748 |
| 5 | Ga0466715_151023 | 3300042616 | Bacteria | 2119 |
| 6 | Ga0466718_057050 | 3300042617 | Bacteria | 9839 |
| 7 | Ga0466723_252499 | 3300042618 | Bacteria | 5108 |
| 8 | Ga0466723_318016 | 3300042618 | Bacteria | 5583 |
| 9 | JGI24698J34947_10009913 | 3300002449 | Bacteria | 5224 |
| 10 | JGI24695J34938_10001567 | 3300002450 | Bacteria | 19252 |
| 11 | JGI24695J34938_10002604 | 3300002450 | Bacteria | 13574 |
| 12 | JGI24699J35502_10869190 | 3300002509 | Unclassified | 987 |
| 13 | Ga0072941_1014211 | 3300005201 | Bacteria | 2943 |
| 14 | Ga0466702_123023 | 3300042635 | Unclassified | 1727 |
| 15 | Ga0466702_190237 | 3300042635 | Bacteria | 3351 |
| 16 | Ga0466690_338507 | 3300042590 | Bacteria | 1037 |
| 17 | Ga0466690_428259 | 3300042590 | Bacteria | 3223 |
| 18 | Ga0466691_135882 | 3300042593 | Bacteria | 15999 |
| 19 | Ga0466696_423932 | 3300042596 | Bacteria | 1953 |
| 20 | Ga0466699_192350 | 3300042597 | Bacteria | 3395 |
| 21 | Ga0466699_318342 | 3300042597 | Bacteria | 12632 |
| 22 | Ga0466699_381781 | 3300042597 | Bacteria | 1426 |
| 23 | Ga0123355_10083363 | 3300009826 | Bacteria | 5096 |
| 24 | Ga0123356_10031373 | 3300010049 | Bacteria | 4972 |
| 25 | Ga0466712_066647 | 3300042614 | Bacteria | 1804 |
| 26 | Ga0466712_240514 | 3300042614 | Bacteria | 1621 |
| 27 | Ga0466711_254994 | 3300042615 | Bacteria | 26854 |
| 28 | Ga0466718_145267 | 3300042617 | Bacteria | 15591 |
| 29 | Ga0466716_305369 | 3300042605 | Bacteria | 6589 |
| 30 | Ga0466720_073458 | 3300042607 | Unclassified | 2585 |
| 31 | Ga0466722_048606 | 3300042609 | Bacteria | 3467 |
| 32 | 2230969590 | 2228664004 | Bacteria | 27562 |
| 33 | AustNasuHG_c1000911 | 3300000089 | Bacteria | 10667 |
| 34 | JGI24698J34947_10020894 | 3300002449 | Bacteria | 3525 |
| 35 | JGI24698J34947_10056762 | 3300002449 | Bacteria | 1945 |
| 36 | JGI24695J34938_10000132 | 3300002450 | Bacteria | 67814 |
| 37 | JGI24702J35022_10043082 | 3300002462 | Bacteria | 2403 |
| 38 | Ga0466731_058799 | 3300042622 | Bacteria | 1854 |
| 39 | Ga0466735_003565 | 3300042624 | Bacteria | 4456 |
| 40 | Ga0466702_002572 | 3300042635 | Bacteria | 1195 |
| 41 | Ga0466708_017458 | 3300042652 | Bacteria | 16555 |
| 42 | Ga0466708_156829 | 3300042652 | Bacteria | 1226 |
| 43 | Ga0466727_037371 | 3300042655 | Bacteria | 1853 |
| 44 | Ga0466727_166955 | 3300042655 | Bacteria | 1441 |
| 45 | Ga0264413_101386 | 3300024493 | Bacteria | 7783 |
| 46 | Ga0466690_396657 | 3300042590 | Bacteria | 14185 |
| 47 | Ga0466693_166031 | 3300042592 | Bacteria | 4977 |
| 48 | Ga0466691_202144 | 3300042593 | Bacteria | 37125 |
| 49 | Ga0466691_216720 | 3300042593 | Bacteria | 10264 |
| 50 | Ga0466694_192488 | 3300042594 | Bacteria | 1725 |
| 51 | Ga0466696_200248 | 3300042596 | Bacteria | 15331 |
| 52 | Ga0466699_007369 | 3300042597 | Bacteria | 4278 |
| 53 | Ga0123356_10621953 | 3300010049 | Bacteria | 1246 |
| 54 | Ga0123353_10572514 | 3300010167 | Bacteria | 1623 |
| 55 | Ga0466712_236565 | 3300042614 | Unclassified | 2576 |
| 56 | Ga0466711_193862 | 3300042615 | Bacteria | 9562 |
| 57 | Ga0466718_067635 | 3300042617 | Bacteria | 12512 |
| 58 | Ga0466723_007155 | 3300042618 | Bacteria | 25180 |
| 59 | Ga0466723_010757 | 3300042618 | Bacteria | 43976 |
| 60 | Ga0466723_025859 | 3300042618 | Bacteria | 2961 |
| 61 | Ga0466723_219676 | 3300042618 | Bacteria | 5369 |
| 62 | Ga0466701_048766 | 3300042598 | Bacteria | 1009 |
| 63 | JGI24698J34947_10000394 | 3300002449 | Bacteria | 19780 |
| 64 | JGI24698J34947_10005671 | 3300002449 | Bacteria | 6844 |
| 65 | JGI24698J34947_10082872 | 3300002449 | Unclassified | 1498 |
| 66 | JGI24695J34938_10004258 | 3300002450 | Bacteria | 9483 |
| 67 | JGI24695J34938_10007275 | 3300002450 | Bacteria | 6520 |
| 68 | JGI24695J34938_10071660 | 3300002450 | Unclassified | 1447 |
| 69 | JGI24702J35022_10015386 | 3300002462 | Bacteria | 4211 |
| 70 | Ga0072941_1014212 | 3300005201 | Bacteria | 4675 |
| 71 | Ga0466702_112422 | 3300042635 | Bacteria | 1218 |
| 72 | Ga0466702_168042 | 3300042635 | Bacteria | 8611 |
| 73 | Ga0466702_248651 | 3300042635 | Bacteria | 1865 |
| 74 | Ga0466704_429340 | 3300042643 | Bacteria | 3296 |
| 75 | Ga0466709_082090 | 3300042648 | Bacteria | 9773 |
| 76 | Ga0466692_113556 | 3300042591 | Bacteria | 3003 |
| 77 | Ga0466705_306579 | 3300042612 | Bacteria | 11644 |
| 78 | Ga0123357_10104382 | 3300009784 | Bacteria | 3640 |
| 79 | Ga0123357_10417612 | 3300009784 | Bacteria | 1201 |
| 80 | Ga0123357_10485729 | 3300009784 | Bacteria | 1039 |
| 81 | Ga0123355_10001757 | 3300009826 | Bacteria | 30298 |
| 82 | Ga0123356_10000340 | 3300010049 | Bacteria | 53881 |
| 83 | Ga0123356_11955630 | 3300010049 | Bacteria | 731 |
| 84 | Ga0466715_062281 | 3300042616 | Bacteria | 4085 |
| 85 | Ga0466715_511523 | 3300042616 | Unclassified | 2007 |
| 86 | Ga0466718_063941 | 3300042617 | Bacteria | 16372 |
| 87 | Ga0466726_205724 | 3300042619 | Bacteria | 1345 |
| 88 | Ga0466728_039246 | 3300042620 | Bacteria | 29985 |
| 89 | Ga0466719_561114 | 3300042606 | Bacteria | 23121 |
| 90 | Ga0466722_082964 | 3300042609 | Bacteria | 56291 |
| 91 | JGI24695J34938_10000389 | 3300002450 | Bacteria | 43422 |
| 92 | Ga0072941_1005300 | 3300005201 | Bacteria | 3231 |
| 93 | Ga0466702_314993 | 3300042635 | Bacteria | 1373 |
| 94 | Ga0466702_370629 | 3300042635 | Bacteria | 1677 |
| 95 | Ga0466709_075195 | 3300042648 | Bacteria | 10461 |
| 96 | Ga0466708_023929 | 3300042652 | Bacteria | 2828 |
| 97 | Ga0264413_101133 | 3300024493 | Bacteria | 21360 |
| 98 | Ga0264413_116430 | 3300024493 | Bacteria | 3141 |
| 99 | Ga0415639_075221 | 3300038395 | Bacteria | 4085 |
| 100 | Ga0466690_130546 | 3300042590 | Unclassified | 1475 |
| 101 | Ga0466690_286538 | 3300042590 | Unclassified | 3994 |
| 102 | Ga0466692_060516 | 3300042591 | Bacteria | 1515 |
| 103 | Ga0466694_006499 | 3300042594 | Bacteria | 16001 |
| 104 | Ga0466699_263910 | 3300042597 | Bacteria | 1435 |
| 105 | Ga0123356_10021995 | 3300010049 | Bacteria | 6022 |
| 106 | Ga0466712_019495 | 3300042614 | Bacteria | 40574 |
| 107 | Ga0466711_094440 | 3300042615 | Bacteria | 6872 |
| 108 | Ga0466718_000332 | 3300042617 | Bacteria | 25424 |
| 109 | Ga0466718_030996 | 3300042617 | Bacteria | 12488 |
| 110 | Ga0466723_063398 | 3300042618 | Bacteria | 10197 |
| 111 | Ga0466726_145230 | 3300042619 | Bacteria | 3637 |
| 112 | Ga0466700_452536 | 3300042600 | Bacteria | 1020 |
| 113 | Ga0466717_019932 | 3300042604 | Bacteria | 1193 |
| 114 | Ga0466720_022531 | 3300042607 | Bacteria | 1979 |
| 115 | JGI24698J34947_10050838 | 3300002449 | Unclassified | 2088 |
| 116 | JGI24698J34947_10066652 | 3300002449 | Unclassified | 1751 |
| 117 | JGI24695J34938_10000140 | 3300002450 | Bacteria | 65738 |
| 118 | JGI24695J34938_10002664 | 3300002450 | Bacteria | 13316 |
| 119 | Ga0072941_1014210 | 3300005201 | Bacteria | 33023 |
| 120 | Ga0072941_1066532 | 3300005201 | Bacteria | 2675 |
| 121 | Ga0466735_228260 | 3300042624 | Unclassified | 1673 |
| 122 | Ga0466702_434840 | 3300042635 | Bacteria | 1236 |
| 123 | Ga0466704_218475 | 3300042643 | Bacteria | 1466 |
| 124 | Ga0466708_217537 | 3300042652 | Bacteria | 33917 |
| 125 | Ga0466690_095471 | 3300042590 | Bacteria | 57449 |
| 126 | Ga0466693_251991 | 3300042592 | Bacteria | 12964 |
| 127 | Ga0466694_281202 | 3300042594 | Bacteria | 5294 |
| 128 | Ga0466699_019486 | 3300042597 | Bacteria | 6799 |
| 129 | Ga0466705_331486 | 3300042612 | Bacteria | 57655 |
| 130 | Ga0466705_361907 | 3300042612 | Bacteria | 9484 |
| 131 | Ga0123356_10966049 | 3300010049 | Bacteria | 1022 |
| 132 | Ga0466719_396187 | 3300042606 | Bacteria | 33459 |
| 133 | JGI24698J34947_10004001 | 3300002449 | Bacteria | 8011 |
| 134 | JGI24695J34938_10000443 | 3300002450 | Bacteria | 40027 |
| 135 | JGI24695J34938_10003560 | 3300002450 | Bacteria | 10753 |
| 136 | Ga0068305_10007620 | 3300005083 | Bacteria | 27204 |
| 137 | Ga0072941_1023895 | 3300005201 | Bacteria | 2716 |
| 138 | Ga0466704_119001 | 3300042643 | Unclassified | 5160 |
| 139 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 140 | Ga0123357_10139761 | 3300009784 | Unclassified | 2981 |
| 141 | Ga0123353_11410118 | 3300010167 | Bacteria | 895 |
| 142 | Ga0466726_031246 | 3300042619 | Bacteria | 1775 |
| 143 | Ga0466720_014617 | 3300042607 | Bacteria | 13721 |
| 144 | Ga0466720_032036 | 3300042607 | Bacteria | 49795 |
| 145 | Ga0466722_127760 | 3300042609 | Bacteria | 1783 |
| 146 | JGI24695J34938_10002193 | 3300002450 | Bacteria | 15232 |
| 147 | Ga0072941_1015472 | 3300005201 | Bacteria | 21539 |
| 148 | Ga0466729_297680 | 3300042621 | Bacteria | 1339 |
| 149 | Ga0466729_305618 | 3300042621 | Unclassified | 1756 |
| 150 | Ga0466702_271913 | 3300042635 | Bacteria | 11478 |
| 151 | Ga0466702_322364 | 3300042635 | Bacteria | 1027 |
| 152 | Ga0264413_128494 | 3300024493 | Bacteria | 1467 |
| 153 | Ga0415639_072203 | 3300038395 | Bacteria | 3694 |
| 154 | Ga0466694_406717 | 3300042594 | Bacteria | 27989 |
| 155 | Ga0466696_152207 | 3300042596 | Bacteria | 33378 |
| 156 | Ga0466699_404786 | 3300042597 | Bacteria | 1547 |
| 157 | Ga0123353_10335125 | 3300010167 | Bacteria | 2288 |
| 158 | Ga0123353_10446945 | 3300010167 | Bacteria | 1905 |
| 159 | Ga0466712_184649 | 3300042614 | Bacteria | 13172 |
| 160 | Ga0466715_392245 | 3300042616 | Bacteria | 49927 |
| 161 | Ga0466718_100884 | 3300042617 | Bacteria | 2043 |
| 162 | Ga0466726_277869 | 3300042619 | Bacteria | 6351 |
| 163 | Ga0466719_024469 | 3300042606 | Unclassified | 1464 |
| 164 | Ga0466698_176121 | 3300042610 | Bacteria | 1900 |
| 165 | Ga0466698_372630 | 3300042610 | Bacteria | 2167 |
| 166 | JGI24698J34947_10059620 | 3300002449 | Bacteria | 1886 |
| 167 | JGI24698J34947_10098203 | 3300002449 | Unclassified | 1324 |
| 168 | JGI24695J34938_10035250 | 3300002450 | Unclassified | 2289 |
| 169 | Ga0466735_061951 | 3300042624 | Unclassified | 2914 |
| 170 | Ga0466704_049139 | 3300042643 | Bacteria | 37521 |
| 171 | Ga0466708_055260 | 3300042652 | Bacteria | 1762 |
| 172 | Ga0466727_343274 | 3300042655 | Bacteria | 2154 |
| 173 | Ga0456237_0007744 | 3300041968 | Bacteria | 1646 |
| 174 | Ga0466695_006127 | 3300042595 | Bacteria | 69665 |
| 175 | Ga0466699_322674 | 3300042597 | Bacteria | 75586 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00227 | Proteasome | Proteasome subunit | 11 | 162 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.