Protein Family IF04875
Metagenome
Isolate
252
Members
62
Samples
235
Scaffolds
324.54
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_078074|Ga0466691_078074_1372_2505
- Length
- 377 aa
- Sequence
- MLHVSKRLNMPVCEYNTGDYKKIQAAAVSFAAVSLPAALLIARSGARGYNRGMSDDSNNTDSAGWFSCDDGTRLFLRRWVSRQDSPDKPRAVLHIVHGMAEHGLRYGRAALRLAESGIEVWAADQRGHGKTADLSVNGPGRGGLAGHCADGDGFSRVTADLDLINGEIKKQRPGVPLFLMGHSWGSLIVQHYIEQYATQGLSGCILSGTRGPGGIKVRAGLPLMVLLAALRGQRKGSSLARAVADGPYNKPFRPNRSPFDWLSRDEKEVDAYVNDPCSGNLCSAGFYRDLIRGLVNIHRKEAMEKIRIDLPVYVFSGSADPVGDMGASPTALVNAYRSAGFKDLEFVLYPDARHETLNETNREEVTENLTSWILQRC
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
30.0%
Kalotermitidae
23.3%
Rhinotermitidae
5.0%
Termopsidae
5.0%
Blaberidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
235
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 2 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 3 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 4 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 5 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 6 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 7 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 22 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 32 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 51 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 52 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 53 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 54 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 59 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 60 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_253072 | 3300042612 | Bacteria | 7085 |
| 2 | Ga0466690_284729 | 3300042590 | Bacteria | 1990 |
| 3 | Ga0466692_177784 | 3300042591 | Bacteria | 1859 |
| 4 | Ga0466693_321093 | 3300042592 | Unclassified | 2863 |
| 5 | Ga0466699_182099 | 3300042597 | Bacteria | 3646 |
| 6 | Ga0466712_258346 | 3300042614 | Bacteria | 6122 |
| 7 | Ga0466711_141805 | 3300042615 | Bacteria | 1663 |
| 8 | Ga0466711_229246 | 3300042615 | Bacteria | 24636 |
| 9 | Ga0466715_080578 | 3300042616 | Bacteria | 1208 |
| 10 | Ga0466723_046763 | 3300042618 | Bacteria | 9345 |
| 11 | Ga0466723_104617 | 3300042618 | Bacteria | 2427 |
| 12 | Ga0466726_293111 | 3300042619 | Bacteria | 4407 |
| 13 | Ga0466703_025198 | 3300042636 | Bacteria | 7962 |
| 14 | Ga0466703_048439 | 3300042636 | Bacteria | 4207 |
| 15 | Ga0466703_115037 | 3300042636 | Bacteria | 4570 |
| 16 | Ga0466704_105657 | 3300042643 | Bacteria | 7738 |
| 17 | Ga0466704_346171 | 3300042643 | Bacteria | 4846 |
| 18 | Ga0466708_223425 | 3300042652 | Bacteria | 6663 |
| 19 | Ga0466708_243335 | 3300042652 | Bacteria | 9682 |
| 20 | Ga0123356_10256917 | 3300010049 | Bacteria | 1828 |
| 21 | Ga0123353_10550725 | 3300010167 | Bacteria | 1664 |
| 22 | Ga0123354_10046161 | 3300010882 | Bacteria | 6660 |
| 23 | Ga0466707_004583 | 3300042601 | Bacteria | 2045 |
| 24 | Ga0466707_207512 | 3300042601 | Bacteria | 2288 |
| 25 | Ga0466707_420587 | 3300042601 | Bacteria | 1430 |
| 26 | Ga0466716_518692 | 3300042605 | Unclassified | 2327 |
| 27 | Ga0466722_005567 | 3300042609 | Bacteria | 6249 |
| 28 | Ga0466722_057635 | 3300042609 | Bacteria | 4590 |
| 29 | Ga0466722_132557 | 3300042609 | Bacteria | 47947 |
| 30 | Ga0072941_1002787 | 3300005201 | Bacteria | 6287 |
| 31 | Ga0466705_042005 | 3300042612 | Bacteria | 2297 |
| 32 | Ga0466705_064066 | 3300042612 | Bacteria | 2945 |
| 33 | Ga0466705_260771 | 3300042612 | Bacteria | 12007 |
| 34 | Ga0466692_022988 | 3300042591 | Bacteria | 4539 |
| 35 | Ga0466691_178223 | 3300042593 | Bacteria | 15896 |
| 36 | Ga0466696_268412 | 3300042596 | Bacteria | 3457 |
| 37 | Ga0466712_149913 | 3300042614 | Bacteria | 9599 |
| 38 | Ga0466715_317228 | 3300042616 | Bacteria | 5753 |
| 39 | Ga0466715_508395 | 3300042616 | Bacteria | 20243 |
| 40 | Ga0466723_262850 | 3300042618 | Bacteria | 2041 |
| 41 | Ga0466726_277146 | 3300042619 | Bacteria | 2592 |
| 42 | Ga0466703_120600 | 3300042636 | Bacteria | 41888 |
| 43 | Ga0466704_024511 | 3300042643 | Bacteria | 22738 |
| 44 | Ga0466704_216914 | 3300042643 | Bacteria | 6133 |
| 45 | Ga0466704_548806 | 3300042643 | Bacteria | 3257 |
| 46 | Ga0466709_310540 | 3300042648 | Bacteria | 3831 |
| 47 | Ga0466709_384590 | 3300042648 | Bacteria | 1954 |
| 48 | Ga0466708_107034 | 3300042652 | Bacteria | 5297 |
| 49 | Ga0466727_230444 | 3300042655 | Bacteria | 2964 |
| 50 | Ga0123355_10474110 | 3300009826 | Bacteria | 1562 |
| 51 | Ga0466707_404465 | 3300042601 | Bacteria | 2579 |
| 52 | Ga0466716_300111 | 3300042605 | Unclassified | 1695 |
| 53 | Ga0466722_071859 | 3300042609 | Bacteria | 13144 |
| 54 | AustNasuHG_c1000130 | 3300000089 | Bacteria | 23339 |
| 55 | Ga0072940_1003188 | 3300005200 | Bacteria | 6321 |
| 56 | Ga0072941_1003391 | 3300005201 | Bacteria | 49941 |
| 57 | Ga0072941_1073785 | 3300005201 | Bacteria | 5169 |
| 58 | Ga0466732_167787 | 3300042656 | Bacteria | 1756 |
| 59 | Ga0466690_079179 | 3300042590 | Bacteria | 6579 |
| 60 | Ga0466694_093288 | 3300042594 | Bacteria | 2123 |
| 61 | Ga0466699_370115 | 3300042597 | Bacteria | 1394 |
| 62 | Ga0466723_049536 | 3300042618 | Bacteria | 40266 |
| 63 | Ga0466723_074347 | 3300042618 | Bacteria | 8950 |
| 64 | Ga0466723_167927 | 3300042618 | Bacteria | 10462 |
| 65 | Ga0466723_277548 | 3300042618 | Bacteria | 7413 |
| 66 | Ga0466723_296859 | 3300042618 | Bacteria | 5414 |
| 67 | Ga0466723_299778 | 3300042618 | Unclassified | 2707 |
| 68 | Ga0466728_230711 | 3300042620 | Bacteria | 1479 |
| 69 | Ga0466728_289962 | 3300042620 | Bacteria | 4108 |
| 70 | Ga0466702_184993 | 3300042635 | Bacteria | 2652 |
| 71 | Ga0466704_606107 | 3300042643 | Bacteria | 43358 |
| 72 | Ga0466708_002034 | 3300042652 | Bacteria | 3817 |
| 73 | Ga0466708_069960 | 3300042652 | Bacteria | 2170 |
| 74 | Ga0466708_072817 | 3300042652 | Bacteria | 22726 |
| 75 | Ga0466708_198938 | 3300042652 | Bacteria | 1422 |
| 76 | Ga0466727_233663 | 3300042655 | Bacteria | 5784 |
| 77 | Ga0123355_10023722 | 3300009826 | Unclassified | 9854 |
| 78 | Ga0123355_10620658 | 3300009826 | Bacteria | 1274 |
| 79 | Ga0123356_10336037 | 3300010049 | Unclassified | 1629 |
| 80 | Ga0123353_10028348 | 3300010167 | Bacteria | 8601 |
| 81 | Ga0123353_10211604 | 3300010167 | Bacteria | 3041 |
| 82 | Ga0123353_10327267 | 3300010167 | Bacteria | 2322 |
| 83 | Ga0466719_155105 | 3300042606 | Bacteria | 2341 |
| 84 | JGI24698J34947_10011112 | 3300002449 | Bacteria | 4942 |
| 85 | JGI24695J34938_10026774 | 3300002450 | Bacteria | 2735 |
| 86 | Ga0072941_1063426 | 3300005201 | Bacteria | 2047 |
| 87 | Ga0466705_260154 | 3300042612 | Bacteria | 7111 |
| 88 | Ga0264413_100247 | 3300024493 | Bacteria | 36643 |
| 89 | Ga0466690_003844 | 3300042590 | Bacteria | 16431 |
| 90 | Ga0466693_117752 | 3300042592 | Bacteria | 4167 |
| 91 | Ga0466691_078074 | 3300042593 | Bacteria | 2648 |
| 92 | Ga0466691_172717 | 3300042593 | Bacteria | 22281 |
| 93 | Ga0466694_000775 | 3300042594 | Bacteria | 1863 |
| 94 | Ga0466699_146851 | 3300042597 | Bacteria | 4536 |
| 95 | Ga0466699_206277 | 3300042597 | Bacteria | 2104 |
| 96 | Ga0466715_098436 | 3300042616 | Bacteria | 8061 |
| 97 | Ga0466718_097601 | 3300042617 | Bacteria | 1214 |
| 98 | Ga0466726_187683 | 3300042619 | Bacteria | 2727 |
| 99 | Ga0466729_310469 | 3300042621 | Bacteria | 1534 |
| 100 | Ga0466703_163152 | 3300042636 | Bacteria | 6470 |
| 101 | Ga0466703_299255 | 3300042636 | Bacteria | 6709 |
| 102 | Ga0466704_428426 | 3300042643 | Bacteria | 5442 |
| 103 | Ga0466709_135457 | 3300042648 | Bacteria | 5586 |
| 104 | Ga0123353_10036107 | 3300010167 | Bacteria | 7740 |
| 105 | Ga0123353_10199406 | 3300010167 | Bacteria | 3150 |
| 106 | Ga0123353_10762115 | 3300010167 | Bacteria | 1345 |
| 107 | Ga0466706_011495 | 3300042599 | Bacteria | 1256 |
| 108 | Ga0466707_077578 | 3300042601 | Unclassified | 1426 |
| 109 | Ga0466716_174476 | 3300042605 | Bacteria | 6678 |
| 110 | Ga0466719_202665 | 3300042606 | Unclassified | 2686 |
| 111 | Ga0466722_067972 | 3300042609 | Bacteria | 19141 |
| 112 | Ga0466722_237118 | 3300042609 | Bacteria | 2820 |
| 113 | Ga0072940_1003187 | 3300005200 | Bacteria | 5939 |
| 114 | Ga0466692_029125 | 3300042591 | Bacteria | 3933 |
| 115 | Ga0466692_154349 | 3300042591 | Bacteria | 12070 |
| 116 | Ga0466691_103251 | 3300042593 | Bacteria | 7593 |
| 117 | Ga0466694_034128 | 3300042594 | Bacteria | 7642 |
| 118 | Ga0466696_083082 | 3300042596 | Bacteria | 3977 |
| 119 | Ga0466699_046509 | 3300042597 | Bacteria | 2347 |
| 120 | Ga0466711_399238 | 3300042615 | Bacteria | 2932 |
| 121 | Ga0466715_000243 | 3300042616 | Bacteria | 6161 |
| 122 | Ga0466715_389456 | 3300042616 | Bacteria | 7885 |
| 123 | Ga0466715_538177 | 3300042616 | Bacteria | 7441 |
| 124 | Ga0466718_004450 | 3300042617 | Bacteria | 11933 |
| 125 | Ga0466726_306130 | 3300042619 | Bacteria | 9106 |
| 126 | Ga0466726_460923 | 3300042619 | Bacteria | 8185 |
| 127 | Ga0466728_047761 | 3300042620 | Bacteria | 13465 |
| 128 | Ga0466728_137619 | 3300042620 | Bacteria | 3960 |
| 129 | Ga0466729_162358 | 3300042621 | Bacteria | 1703 |
| 130 | Ga0466735_172648 | 3300042624 | Bacteria | 1885 |
| 131 | Ga0466703_214743 | 3300042636 | Bacteria | 12060 |
| 132 | Ga0466703_395781 | 3300042636 | Bacteria | 8158 |
| 133 | Ga0466704_052533 | 3300042643 | Bacteria | 38076 |
| 134 | Ga0466709_355262 | 3300042648 | Bacteria | 2595 |
| 135 | Ga0466708_376341 | 3300042652 | Bacteria | 2177 |
| 136 | Ga0466700_057262 | 3300042600 | Bacteria | 1124 |
| 137 | Ga0466707_405220 | 3300042601 | Bacteria | 2147 |
| 138 | Ga0466713_044006 | 3300042602 | Bacteria | 13839 |
| 139 | Ga0466716_140743 | 3300042605 | Bacteria | 26918 |
| 140 | JGI24698J34947_10034239 | 3300002449 | Bacteria | 2660 |
| 141 | Ga0466705_053232 | 3300042612 | Unclassified | 2795 |
| 142 | Ga0466705_089841 | 3300042612 | Bacteria | 2187 |
| 143 | Ga0466690_137190 | 3300042590 | Bacteria | 25103 |
| 144 | Ga0466690_142593 | 3300042590 | Bacteria | 4188 |
| 145 | Ga0466692_016800 | 3300042591 | Bacteria | 7786 |
| 146 | Ga0466692_032782 | 3300042591 | Bacteria | 5962 |
| 147 | Ga0466694_298431 | 3300042594 | Bacteria | 2085 |
| 148 | Ga0466695_150699 | 3300042595 | Bacteria | 2722 |
| 149 | Ga0466696_471705 | 3300042596 | Bacteria | 10519 |
| 150 | Ga0466711_373151 | 3300042615 | Bacteria | 3322 |
| 151 | Ga0466715_132304 | 3300042616 | Bacteria | 8456 |
| 152 | Ga0466718_050558 | 3300042617 | Bacteria | 40017 |
| 153 | Ga0466718_103591 | 3300042617 | Bacteria | 1925 |
| 154 | Ga0466723_342391 | 3300042618 | Bacteria | 1747 |
| 155 | Ga0466726_378497 | 3300042619 | Bacteria | 7862 |
| 156 | Ga0466728_004251 | 3300042620 | Bacteria | 5111 |
| 157 | Ga0466728_037239 | 3300042620 | Unclassified | 7366 |
| 158 | Ga0466704_567146 | 3300042643 | Bacteria | 34616 |
| 159 | Ga0466709_137317 | 3300042648 | Bacteria | 9149 |
| 160 | Ga0466708_084228 | 3300042652 | Bacteria | 4715 |
| 161 | Ga0466708_208027 | 3300042652 | Bacteria | 1797 |
| 162 | Ga0123355_10555079 | 3300009826 | Unclassified | 1386 |
| 163 | Ga0123356_10268167 | 3300010049 | Bacteria | 1795 |
| 164 | Ga0123353_10509240 | 3300010167 | Bacteria | 1751 |
| 165 | Ga0123353_10567511 | 3300010167 | Bacteria | 1632 |
| 166 | Ga0123353_10841335 | 3300010167 | Bacteria | 1259 |
| 167 | Ga0466707_315923 | 3300042601 | Bacteria | 2572 |
| 168 | Ga0466707_326003 | 3300042601 | Bacteria | 2716 |
| 169 | Ga0466719_072901 | 3300042606 | Bacteria | 5452 |
| 170 | Ga0466719_086760 | 3300042606 | Bacteria | 3493 |
| 171 | Ga0466719_143231 | 3300042606 | Bacteria | 2719 |
| 172 | Ga0466722_216365 | 3300042609 | Bacteria | 4397 |
| 173 | JGI24695J34938_10000202 | 3300002450 | Bacteria | 56335 |
| 174 | JGI24695J34938_10005608 | 3300002450 | Bacteria | 7776 |
| 175 | JGI24695J34938_10050001 | 3300002450 | Bacteria | 1835 |
| 176 | Ga0466732_212235 | 3300042656 | Bacteria | 1719 |
| 177 | Ga0466691_016174 | 3300042593 | Bacteria | 8456 |
| 178 | Ga0466691_209964 | 3300042593 | Bacteria | 2776 |
| 179 | Ga0466694_075104 | 3300042594 | Bacteria | 33181 |
| 180 | Ga0466696_010362 | 3300042596 | Bacteria | 5943 |
| 181 | Ga0466696_018144 | 3300042596 | Bacteria | 6523 |
| 182 | Ga0466696_244862 | 3300042596 | Bacteria | 20694 |
| 183 | Ga0466699_005857 | 3300042597 | Bacteria | 25238 |
| 184 | Ga0466715_515972 | 3300042616 | Bacteria | 6145 |
| 185 | Ga0466723_201252 | 3300042618 | Bacteria | 2697 |
| 186 | Ga0466728_130142 | 3300042620 | Bacteria | 19155 |
| 187 | Ga0466704_365327 | 3300042643 | Bacteria | 8394 |
| 188 | Ga0466704_433789 | 3300042643 | Bacteria | 54851 |
| 189 | Ga0123356_10661377 | 3300010049 | Bacteria | 1212 |
| 190 | Ga0123353_10142841 | 3300010167 | Bacteria | 3832 |
| 191 | Ga0466716_191893 | 3300042605 | Bacteria | 3481 |
| 192 | Ga0466719_423951 | 3300042606 | Bacteria | 2911 |
| 193 | Ga0466722_089618 | 3300042609 | Bacteria | 5884 |
| 194 | 2230930141 | 2228664001 | Bacteria | 2672 |
| 195 | AustNasuHG_c1002897 | 3300000089 | Bacteria | 6195 |
| 196 | JGI24698J34947_10013901 | 3300002449 | Bacteria | 4387 |
| 197 | JGI24698J34947_10041168 | 3300002449 | Bacteria | 2381 |
| 198 | JGI24702J35022_10001249 | 3300002462 | Bacteria | 15845 |
| 199 | JGI24702J35022_10108623 | 3300002462 | Bacteria | 1524 |
| 200 | Ga0466705_270690 | 3300042612 | Bacteria | 5878 |
| 201 | Ga0264413_106747 | 3300024493 | Unclassified | 6927 |
| 202 | Ga0466692_183110 | 3300042591 | Bacteria | 5681 |
| 203 | Ga0466691_020778 | 3300042593 | Bacteria | 6618 |
| 204 | Ga0466691_037663 | 3300042593 | Unclassified | 1091 |
| 205 | Ga0466691_131090 | 3300042593 | Bacteria | 6708 |
| 206 | Ga0466691_199219 | 3300042593 | Unclassified | 2092 |
| 207 | Ga0466694_082345 | 3300042594 | Bacteria | 2258 |
| 208 | Ga0466696_026430 | 3300042596 | Bacteria | 6209 |
| 209 | Ga0466696_142355 | 3300042596 | Bacteria | 13180 |
| 210 | Ga0466699_186068 | 3300042597 | Bacteria | 2897 |
| 211 | Ga0466699_219766 | 3300042597 | Bacteria | 9537 |
| 212 | Ga0466699_249744 | 3300042597 | Bacteria | 3918 |
| 213 | Ga0466712_186414 | 3300042614 | Unclassified | 3932 |
| 214 | Ga0466715_476820 | 3300042616 | Bacteria | 24646 |
| 215 | Ga0466723_022137 | 3300042618 | Unclassified | 7324 |
| 216 | Ga0466726_174923 | 3300042619 | Bacteria | 16514 |
| 217 | Ga0466702_023402 | 3300042635 | Bacteria | 1418 |
| 218 | Ga0466702_244863 | 3300042635 | Bacteria | 4491 |
| 219 | Ga0466703_159280 | 3300042636 | Bacteria | 6445 |
| 220 | Ga0466703_257394 | 3300042636 | Bacteria | 3674 |
| 221 | Ga0466703_413866 | 3300042636 | Bacteria | 1752 |
| 222 | Ga0466709_351522 | 3300042648 | Bacteria | 13513 |
| 223 | Ga0466709_411737 | 3300042648 | Bacteria | 11793 |
| 224 | Ga0466708_013698 | 3300042652 | Bacteria | 10814 |
| 225 | Ga0466708_034324 | 3300042652 | Bacteria | 1199 |
| 226 | Ga0466708_464372 | 3300042652 | Bacteria | 26592 |
| 227 | Ga0123355_10003855 | 3300009826 | Bacteria | 21692 |
| 228 | Ga0123356_10000635 | 3300010049 | Bacteria | 38756 |
| 229 | Ga0123356_10233887 | 3300010049 | Bacteria | 1904 |
| 230 | Ga0466707_370299 | 3300042601 | Unclassified | 1225 |
| 231 | Ga0466716_036339 | 3300042605 | Bacteria | 2968 |
| 232 | Ga0466720_166283 | 3300042607 | Bacteria | 5958 |
| 233 | JGI24695J34938_10001606 | 3300002450 | Bacteria | 19014 |
| 234 | JGI24702J35022_10003288 | 3300002462 | Bacteria | 9761 |
| 235 | Ga0072941_1000220 | 3300005201 | Bacteria | 57867 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.