Protein Family IF04872
Metagenome
Isolate
131
Members
52
Samples
120
Scaffolds
126.85
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_068237|Ga0466691_068237_974_1357
- Length
- 127 aa
- Sequence
- MTENELSKIVFEAGLKIHRALGPGLLENAYEECLYYELEKKCGLFVEKQKTLPLIYEEVRLDAGYRVDIMVENKLIIEAKSVSELTNLHWAQILTYLKLSHCKLGLLINFNTVLFKDGVRRVINGTL
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
58.0%
Unclassified
14.0%
Kalotermitidae
12.0%
Passalidae
6.0%
Hydrophilidae
4.0%
Elmidae
2.0%
Termopsidae
2.0%
Rhinotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 22 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 25 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 26 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 27 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 36 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 37 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 50 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466698_268740 | 3300042610 | Bacteria | 2151 |
| 2 | Ga0466697_047606 | 3300042611 | Bacteria | 2884 |
| 3 | Ga0466691_126670 | 3300042593 | Bacteria | 6181 |
| 4 | Ga0466695_192782 | 3300042595 | Bacteria | 3810 |
| 5 | Ga0466710_288975 | 3300042613 | Bacteria | 1527 |
| 6 | Ga0466711_503292 | 3300042615 | Unclassified | 3271 |
| 7 | Ga0466724_55884 | 3300042649 | Bacteria | 1991 |
| 8 | Ga0123356_10258676 | 3300010049 | Bacteria | 1823 |
| 9 | Ga0123353_10278891 | 3300010167 | Bacteria | 2568 |
| 10 | Ga0123353_11317708 | 3300010167 | Bacteria | 936 |
| 11 | Ga0123353_13434470 | 3300010167 | Unclassified | 502 |
| 12 | Ga0123354_10267702 | 3300010882 | Bacteria | 1690 |
| 13 | JGI24702J35022_10141016 | 3300002462 | Bacteria | 1345 |
| 14 | Ga0466733_152774 | 3300042659 | Bacteria | 1283 |
| 15 | Ga0466700_241294 | 3300042600 | Bacteria | 2037 |
| 16 | Ga0466717_278652 | 3300042604 | Bacteria | 1845 |
| 17 | Ga0466697_052926 | 3300042611 | Bacteria | 1277 |
| 18 | Ga0466715_273782 | 3300042616 | Bacteria | 2040 |
| 19 | Ga0466734_125780 | 3300042623 | Bacteria | 2691 |
| 20 | Ga0123356_10018848 | 3300010049 | Bacteria | 6549 |
| 21 | Ga0123356_10066282 | 3300010049 | Bacteria | 3379 |
| 22 | Ga0123356_11430729 | 3300010049 | Bacteria | 851 |
| 23 | Ga0123353_10285253 | 3300010167 | Bacteria | 2532 |
| 24 | Ga0123353_10644114 | 3300010167 | Bacteria | 1502 |
| 25 | Ga0123353_11230494 | 3300010167 | Bacteria | 979 |
| 26 | Ga0123353_11624664 | 3300010167 | Bacteria | 814 |
| 27 | JGI24702J35022_10384549 | 3300002462 | Bacteria | 845 |
| 28 | Ga0072940_1058817 | 3300005200 | Unclassified | 1078 |
| 29 | Ga0466700_142945 | 3300042600 | Bacteria | 1624 |
| 30 | Ga0466700_155309 | 3300042600 | Bacteria | 1231 |
| 31 | Ga0466720_074076 | 3300042607 | Bacteria | 1256 |
| 32 | Ga0466657_300375 | 3300042582 | Bacteria | 9572 |
| 33 | Ga0466699_227849 | 3300042597 | Bacteria | 3110 |
| 34 | Ga0466711_056547 | 3300042615 | Bacteria | 1175 |
| 35 | Ga0466715_174786 | 3300042616 | Bacteria | 1180 |
| 36 | Ga0466734_106080 | 3300042623 | Bacteria | 1033 |
| 37 | Ga0466734_110192 | 3300042623 | Bacteria | 1577 |
| 38 | Ga0466709_284722 | 3300042648 | Bacteria | 2424 |
| 39 | Ga0123357_10302207 | 3300009784 | Bacteria | 1614 |
| 40 | Ga0123356_10008796 | 3300010049 | Bacteria | 10002 |
| 41 | Ga0123356_11054299 | 3300010049 | Bacteria | 982 |
| 42 | Ga0123353_10550556 | 3300010167 | Bacteria | 1664 |
| 43 | Ga0123353_10777258 | 3300010167 | Bacteria | 1327 |
| 44 | 2227064280 | 2225789003 | Unclassified | 733 |
| 45 | JGI24705J35276_12014182 | 3300002504 | Bacteria | 865 |
| 46 | JGI24696J40584_12717951 | 3300002834 | Bacteria | 756 |
| 47 | Ga0072941_1094590 | 3300005201 | Bacteria | 4042 |
| 48 | Ga0466690_081462 | 3300042590 | Bacteria | 1004 |
| 49 | Ga0466694_140247 | 3300042594 | Bacteria | 1658 |
| 50 | Ga0466699_120865 | 3300042597 | Bacteria | 2725 |
| 51 | Ga0466731_005319 | 3300042622 | Bacteria | 1554 |
| 52 | Ga0466731_139752 | 3300042622 | Bacteria | 1069 |
| 53 | Ga0466730_085398 | 3300042625 | Bacteria | 165939 |
| 54 | Ga0123353_10683812 | 3300010167 | Bacteria | 1444 |
| 55 | Ga0123353_11113668 | 3300010167 | Bacteria | 1047 |
| 56 | Ga0123353_11126560 | 3300010167 | Bacteria | 1039 |
| 57 | Ga0123353_11942505 | 3300010167 | Bacteria | 724 |
| 58 | Ga0123354_10635462 | 3300010882 | Bacteria | 768 |
| 59 | 2227068538 | 2225789003 | Unclassified | 607 |
| 60 | 2227566609 | 2225789004 | Bacteria | 2660 |
| 61 | IMNBL1DRAFT_c0018893 | 3300000062 | Bacteria | 2847 |
| 62 | Ga0466732_452318 | 3300042656 | Bacteria | 3821 |
| 63 | Ga0466716_018359 | 3300042605 | Bacteria | 2311 |
| 64 | Ga0466690_190384 | 3300042590 | Bacteria | 7440 |
| 65 | Ga0466691_068237 | 3300042593 | Bacteria | 2110 |
| 66 | Ga0466695_004919 | 3300042595 | Bacteria | 5103 |
| 67 | Ga0466711_207404 | 3300042615 | Unclassified | 1603 |
| 68 | Ga0466702_351183 | 3300042635 | Bacteria | 1340 |
| 69 | Ga0466709_026077 | 3300042648 | Bacteria | 1085 |
| 70 | Ga0466725_191735 | 3300042654 | Bacteria | 1761 |
| 71 | Ga0123357_10141782 | 3300009784 | Bacteria | 2951 |
| 72 | Ga0123356_10107857 | 3300010049 | Bacteria | 2684 |
| 73 | Ga0123356_10408665 | 3300010049 | Bacteria | 1497 |
| 74 | Ga0123356_11354757 | 3300010049 | Bacteria | 873 |
| 75 | Ga0123356_13506408 | 3300010049 | Bacteria | 544 |
| 76 | Ga0123353_11110905 | 3300010167 | Bacteria | 1048 |
| 77 | Ga0123353_12605266 | 3300010167 | Bacteria | 598 |
| 78 | JGI24702J35022_10023312 | 3300002462 | Bacteria | 3347 |
| 79 | Ga0466700_221175 | 3300042600 | Bacteria | 6585 |
| 80 | Ga0466722_126710 | 3300042609 | Bacteria | 1644 |
| 81 | Ga0265387_1096196 | 3300024582 | Bacteria | 610 |
| 82 | Ga0415639_014878 | 3300038395 | Unclassified | 2162 |
| 83 | Ga0466695_108734 | 3300042595 | Bacteria | 1199 |
| 84 | Ga0466711_070179 | 3300042615 | Bacteria | 6432 |
| 85 | Ga0466727_090657 | 3300042655 | Bacteria | 23400 |
| 86 | Ga0466727_161533 | 3300042655 | Bacteria | 2933 |
| 87 | Ga0123357_10259225 | 3300009784 | Bacteria | 1842 |
| 88 | Ga0123357_10610588 | 3300009784 | Unclassified | 831 |
| 89 | Ga0123356_10888902 | 3300010049 | Bacteria | 1062 |
| 90 | Ga0123353_12326426 | 3300010167 | Bacteria | 643 |
| 91 | IMNBL1DRAFT_c0011397 | 3300000062 | Bacteria | 4154 |
| 92 | JGI24702J35022_10066219 | 3300002462 | Bacteria | 1938 |
| 93 | JGI24702J35022_10253277 | 3300002462 | Bacteria | 1025 |
| 94 | JGI24696J40584_12502678 | 3300002834 | Bacteria | 600 |
| 95 | Ga0466701_072414 | 3300042598 | Bacteria | 1373 |
| 96 | Ga0466714_145513 | 3300042603 | Bacteria | 15989 |
| 97 | Ga0466698_374143 | 3300042610 | Unclassified | 2162 |
| 98 | Ga0466734_004231 | 3300042623 | Bacteria | 1265 |
| 99 | Ga0466734_069339 | 3300042623 | Bacteria | 1120 |
| 100 | Ga0123356_10231734 | 3300010049 | Bacteria | 1911 |
| 101 | Ga0123356_10504149 | 3300010049 | Bacteria | 1367 |
| 102 | Ga0123356_13516496 | 3300010049 | Bacteria | 543 |
| 103 | Ga0123353_10560617 | 3300010167 | Bacteria | 1645 |
| 104 | Ga0123353_10733187 | 3300010167 | Bacteria | 1379 |
| 105 | Ga0123353_10777354 | 3300010167 | Bacteria | 1327 |
| 106 | Ga0123353_13002203 | 3300010167 | Bacteria | 546 |
| 107 | JGI24705J35276_11889522 | 3300002504 | Bacteria | 743 |
| 108 | Ga0466701_053215 | 3300042598 | Bacteria | 3145 |
| 109 | Ga0466694_223693 | 3300042594 | Bacteria | 1562 |
| 110 | Ga0466694_238396 | 3300042594 | Bacteria | 1967 |
| 111 | Ga0466710_225785 | 3300042613 | Bacteria | 1156 |
| 112 | Ga0466711_170255 | 3300042615 | Bacteria | 58662 |
| 113 | Ga0123356_10574403 | 3300010049 | Bacteria | 1290 |
| 114 | Ga0123356_11542152 | 3300010049 | Unclassified | 821 |
| 115 | Ga0123356_11582516 | 3300010049 | Bacteria | 811 |
| 116 | Ga0123353_10969176 | 3300010167 | Bacteria | 1147 |
| 117 | Ga0123354_10357013 | 3300010882 | Bacteria | 1294 |
| 118 | JGI24702J35022_10283312 | 3300002462 | Bacteria | 973 |
| 119 | JGI24705J35276_12059203 | 3300002504 | Bacteria | 932 |
| 120 | Ga0072941_1528084 | 3300005201 | Bacteria | 595 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13366 | PDDEXK_3 | PD-(D/E)XK nuclease superfamily | 5 | 122 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.