Protein Family IF04869

Metagenome Isolate
143 Members
74 Samples
99 Scaffolds
236.36 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_061030|Ga0466691_061030_2528_3322
Length
264 aa
Sequence
MKCIIVDDEPIARRGIKKLVEQNPVLELSDTFNSAEAAAVFMKSRQVDLVFLDIQMPGISGIEFAGSIPKTTLVIFTTAFTEYALDSYEVDAIAYLVKPVEADKFRKAVDKAIAYHSLLLDEEKKSLENTGDDCIFVKSERRYFRVNLKDILFVEGLKDYVILQLDGQRIITRMSLKSVQELLPADRFLRINRSYIVNRERIDSFDNNDAFIQSHEIAIGNSYRNLFFEELMGKGRVKITILLLPYLPELDTRQPLRTSGYGFF

📊 Sample Types

Isolate 30.1%
Metagenome 69.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 28.8%
Kalotermitidae 17.8%
Unclassified 9.6%
Termitidae 8.2%
Elmidae 6.8%
Rhinotermitidae 6.8%
Armadillidiidae 5.5%
Drosophilidae 4.1%
Hydrophilidae 2.7%
Apidae 2.7%
Passalidae 2.7%
Tenebrionidae 1.4%
Hodotermitidae 1.4%
Culicidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
15 3300005308 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut Metagenome Drosophilidae
16 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
17 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
18 2922326829 Bacteroides sp. 224 Isolate Blattidae
19 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
23 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
24 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
25 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
26 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
27 2832343623 Apibacter adventoris wkB180 Isolate Apidae
28 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
29 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
30 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
31 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
32 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
39 3004672520 Bacteroides sp. 51 Isolate Blattidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
42 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
43 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
44 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
45 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
46 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
47 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
48 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
52 3004667792 Bacteroides sp. 519 Isolate Blattidae
53 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
54 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
55 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
56 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
61 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
62 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
63 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
64 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
68 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
69 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
70 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
71 2832372155 Apibacter adventoris wkB301 Isolate Apidae
72 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
73 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
74 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_062323 3300042659 Bacteria 49584
2 Ga0562377_0004 3300056842 Bacteria 3525959
3 Ga0160457_1000843 3300012858 Bacteria 10706
4 Ga0466691_131156 3300042593 Bacteria 21071
5 Ga0466714_066533 3300042603 Bacteria 2821
6 Ga0466716_262367 3300042605 Bacteria 8990
7 2227097469 2225789004 Bacteria 9704
8 IMNBL1DRAFT_c0000275 3300000062 Bacteria 45397
9 Ga0466705_074726 3300042612 Bacteria 1974
10 Ga0466705_084719 3300042612 Bacteria 2799
11 Ga0466704_120050 3300042643 Bacteria 1125
12 Ga0466724_09429 3300042649 Bacteria 389876
13 Ga0466715_003229 3300042616 Bacteria 7536
14 Ga0466723_073709 3300042618 Bacteria 8114
15 Ga0466733_117754 3300042659 Bacteria 7100
16 Ga0466691_061030 3300042593 Bacteria 4359
17 Ga0466696_438390 3300042596 Bacteria 18049
18 Ga0466706_191496 3300042599 Bacteria 3463
19 Ga0466707_393075 3300042601 Bacteria 10069
20 Ga0466713_057950 3300042602 Bacteria 11972
21 Ga0466719_053867 3300042606 Unclassified 9508
22 Ga0466722_021060 3300042609 Bacteria 1807
23 Ga0068305_10198080 3300005083 Unclassified 2306
24 Ga0074310_1021054 3300005308 Bacteria 1592
25 Ga0466703_319661 3300042636 Bacteria 11976
26 Ga0466704_184109 3300042643 Bacteria 2236
27 Ga0466709_278062 3300042648 Bacteria 13010
28 Ga0466709_294543 3300042648 Bacteria 4139
29 Ga0466705_474341 3300042612 Bacteria 80430
30 Ga0160433_100077 3300012846 Bacteria 103687
31 Ga0466690_153772 3300042590 Bacteria 6383
32 Ga0466713_109457 3300042602 Bacteria 80949
33 IMNBL1DRAFT_c0004266 3300000062 Bacteria 8657
34 Ga0104019_1035047 3300007150 Bacteria 2879
35 Ga0104019_1191487 3300007150 Unclassified 1803
36 Ga0466704_072128 3300042643 Bacteria 2878
37 Ga0466704_298474 3300042643 Bacteria 25730
38 Ga0466704_322112 3300042643 Bacteria 12910
39 Ga0466709_375824 3300042648 Bacteria 15389
40 Ga0466729_151279 3300042621 Bacteria 5720
41 Ga0160443_100131 3300012848 Bacteria 111815
42 Ga0466691_001697 3300042593 Bacteria 4836
43 Ga0466696_041806 3300042596 Bacteria 9300
44 Ga0466696_177143 3300042596 Unclassified 1085
45 Ga0466713_134989 3300042602 Bacteria 147812
46 Ga0466719_057486 3300042606 Bacteria 25200
47 2227194692 2225789004 Bacteria 7872
48 Ga0074310_1126075 3300005308 Bacteria 1577
49 Ga0104045_1004398 3300007085 Bacteria 2573
50 Ga0466705_191266 3300042612 Bacteria 24237
51 Ga0466703_190886 3300042636 Bacteria 1543
52 Ga0466704_262732 3300042643 Bacteria 4408
53 Ga0466704_294990 3300042643 Bacteria 2391
54 Ga0466709_133488 3300042648 Bacteria 69029
55 Ga0466711_156092 3300042615 Bacteria 8347
56 Ga0466715_619168 3300042616 Bacteria 7830
57 Ga0466733_091037 3300042659 Bacteria 6454
58 Ga0160443_100015 3300012848 Bacteria 436093
59 Ga0104045_1001650 3300007085 Bacteria 3108
60 Ga0104045_1080783 3300007085 Unclassified 1172
61 Ga0466705_078006 3300042612 Bacteria 3949
62 Ga0466703_062171 3300042636 Bacteria 2112
63 Ga0466704_051808 3300042643 Bacteria 24293
64 Ga0466704_052032 3300042643 Unclassified 2127
65 Ga0466705_439145 3300042612 Bacteria 6161
66 Ga0466733_012468 3300042659 Bacteria 49821
67 Ga0466733_019214 3300042659 Bacteria 126944
68 Ga0466733_206038 3300042659 Bacteria 4867
69 Ga0160453_100015 3300012814 Bacteria 282454
70 Ga0466701_009529 3300042598 Bacteria 375690
71 Ga0466719_402663 3300042606 Bacteria 1683
72 Ga0466722_041013 3300042609 Unclassified 2224
73 2227654359 2225789004 Bacteria 1984
74 Ga0466705_270455 3300042612 Bacteria 3854
75 Ga0466731_294381 3300042622 Bacteria 1160
76 Ga0466730_021757 3300042625 Bacteria 584842
77 Ga0466703_150468 3300042636 Bacteria 6593
78 Ga0466709_215706 3300042648 Bacteria 50492
79 Ga0466711_126967 3300042615 Bacteria 6563
80 Ga0466729_112017 3300042621 Bacteria 1206
81 Ga0466733_115521 3300042659 Bacteria 4792
82 Ga0466733_178434 3300042659 Unclassified 2903
83 Ga0466733_221565 3300042659 Bacteria 17162
84 Ga0160470_102404 3300012813 Bacteria 3546
85 Ga0160467_103109 3300012829 Bacteria 3023
86 Ga0466713_091714 3300042602 Bacteria 189911
87 Ga0466709_168448 3300042648 Bacteria 24997
88 Ga0466723_120598 3300042618 Bacteria 7842
89 Ga0466729_140458 3300042621 Unclassified 10434
90 Ga0466733_003794 3300042659 Bacteria 34484
91 Ga0466733_086839 3300042659 Bacteria 20556
92 Ga0466733_216697 3300042659 Bacteria 189231
93 Ga0466701_036115 3300042598 Bacteria 39022
94 IMNBL1DRAFT_c0027550 3300000062 Bacteria 2134
95 Ga0466704_287925 3300042643 Bacteria 11633
96 Ga0466704_316040 3300042643 Bacteria 19712
97 Ga0466704_611298 3300042643 Unclassified 3565
98 Ga0466708_395678 3300042652 Bacteria 1312
99 Ga0466715_541548 3300042616 Unclassified 5872

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 4 109 0.92
PF04397 LytTR LytTr DNA-binding domain 142 230 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP
PF04397 GO:0003677 DNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.