Protein Family IF04800
Metagenome
Isolate
109
Members
40
Samples
105
Scaffolds
248
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_343356|Ga0466693_343356_5155_6000
- Length
- 281 aa
- Sequence
- LKVDFAVPELCLAWQIRLFPVSCKPMPRNITYTALTLRVKASGESNRETWFLTAEEGIVKATVFGGPKSRLRSRVAPFHEGTLWVYHDPVRDSRKVSDFDVRSYRQGIRELYERVMTADAVAQTILESSGGGGNWQTAARLAAGVLDGIAGADAALCTRLGVYFLWHWADILGIRPDLAACAACGNQTPRNEPLHFHAANQTLLCGDCSQGEDEYSLPTSLRQPIKVSPGARLWLHRIENLPPESLARFTLDNTSLEQAKTLSKAVLTRAFEKRLPTWDGI
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.5%
Kalotermitidae
32.5%
Unclassified
17.5%
Rhinotermitidae
7.5%
Termopsidae
5.0%
Taxonomy
Archaea
0
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_063080 | 3300042659 | Bacteria | 29367 |
| 2 | Ga0466733_141420 | 3300042659 | Bacteria | 62681 |
| 3 | Ga0466733_163811 | 3300042659 | Unclassified | 6581 |
| 4 | Ga0466712_018665 | 3300042614 | Bacteria | 35330 |
| 5 | Ga0466711_352525 | 3300042615 | Bacteria | 66792 |
| 6 | Ga0466723_140965 | 3300042618 | Bacteria | 12276 |
| 7 | Ga0466707_351764 | 3300042601 | Bacteria | 1891 |
| 8 | Ga0466716_133126 | 3300042605 | Bacteria | 1923 |
| 9 | Ga0466722_087782 | 3300042609 | Bacteria | 5653 |
| 10 | Ga0466735_059358 | 3300042624 | Bacteria | 5334 |
| 11 | Ga0466703_368445 | 3300042636 | Bacteria | 2113 |
| 12 | Ga0466709_186972 | 3300042648 | Bacteria | 1997 |
| 13 | Ga0466709_278568 | 3300042648 | Bacteria | 3047 |
| 14 | Ga0466690_097456 | 3300042590 | Bacteria | 9815 |
| 15 | JGI24698J34947_10006811 | 3300002449 | Bacteria | 6280 |
| 16 | Ga0466705_050316 | 3300042612 | Bacteria | 19211 |
| 17 | Ga0123353_11170811 | 3300010167 | Bacteria | 1012 |
| 18 | Ga0466712_117050 | 3300042614 | Bacteria | 4934 |
| 19 | Ga0466711_081327 | 3300042615 | Bacteria | 5713 |
| 20 | Ga0466718_137795 | 3300042617 | Bacteria | 1056 |
| 21 | Ga0466726_179745 | 3300042619 | Bacteria | 2153 |
| 22 | Ga0466707_392900 | 3300042601 | Bacteria | 1082 |
| 23 | Ga0466713_084112 | 3300042602 | Unclassified | 1391 |
| 24 | Ga0466720_104985 | 3300042607 | Unclassified | 2214 |
| 25 | Ga0466709_013054 | 3300042648 | Bacteria | 3566 |
| 26 | Ga0456237_0000603 | 3300041968 | Bacteria | 5494 |
| 27 | Ga0456237_0013967 | 3300041968 | Bacteria | 1147 |
| 28 | Ga0466690_269898 | 3300042590 | Bacteria | 1491 |
| 29 | Ga0466694_071679 | 3300042594 | Bacteria | 3149 |
| 30 | Ga0068305_10027608 | 3300005083 | Bacteria | 9049 |
| 31 | Ga0123353_10045899 | 3300010167 | Bacteria | 6938 |
| 32 | Ga0466723_065737 | 3300042618 | Bacteria | 6964 |
| 33 | Ga0466723_342585 | 3300042618 | Bacteria | 1428 |
| 34 | Ga0466690_195028 | 3300042590 | Bacteria | 11044 |
| 35 | JGI24705J35276_12179194 | 3300002504 | Bacteria | 1353 |
| 36 | Ga0466705_038872 | 3300042612 | Bacteria | 13503 |
| 37 | Ga0123353_10023541 | 3300010167 | Bacteria | 9328 |
| 38 | Ga0466712_242529 | 3300042614 | Bacteria | 8036 |
| 39 | Ga0466715_010529 | 3300042616 | Bacteria | 11517 |
| 40 | Ga0466715_297702 | 3300042616 | Bacteria | 7527 |
| 41 | Ga0466709_003530 | 3300042648 | Bacteria | 4422 |
| 42 | Ga0466690_240126 | 3300042590 | Bacteria | 1338 |
| 43 | Ga0466694_047806 | 3300042594 | Bacteria | 11279 |
| 44 | Ga0466694_101023 | 3300042594 | Bacteria | 13807 |
| 45 | JGI24698J34947_10018112 | 3300002449 | Unclassified | 3811 |
| 46 | JGI24698J34947_10029199 | 3300002449 | Bacteria | 2914 |
| 47 | Ga0466705_128976 | 3300042612 | Bacteria | 3537 |
| 48 | Ga0123355_10083444 | 3300009826 | Bacteria | 5094 |
| 49 | Ga0466712_054354 | 3300042614 | Bacteria | 3914 |
| 50 | Ga0466712_130382 | 3300042614 | Bacteria | 1299 |
| 51 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 52 | Ga0466719_053280 | 3300042606 | Bacteria | 1153 |
| 53 | Ga0466719_394976 | 3300042606 | Bacteria | 13368 |
| 54 | Ga0466704_093891 | 3300042643 | Bacteria | 45240 |
| 55 | Ga0466704_288260 | 3300042643 | Bacteria | 16251 |
| 56 | Ga0466692_182761 | 3300042591 | Bacteria | 12309 |
| 57 | JGI24702J35022_10269092 | 3300002462 | Bacteria | 997 |
| 58 | Ga0123356_10957826 | 3300010049 | Bacteria | 1027 |
| 59 | Ga0466712_133895 | 3300042614 | Bacteria | 5203 |
| 60 | Ga0466715_126305 | 3300042616 | Bacteria | 4696 |
| 61 | Ga0466718_044499 | 3300042617 | Bacteria | 1768 |
| 62 | Ga0466726_314320 | 3300042619 | Bacteria | 1499 |
| 63 | Ga0466719_174880 | 3300042606 | Bacteria | 12435 |
| 64 | Ga0466720_004264 | 3300042607 | Bacteria | 2625 |
| 65 | Ga0466722_250320 | 3300042609 | Bacteria | 1740 |
| 66 | Ga0466703_155902 | 3300042636 | Bacteria | 14184 |
| 67 | Ga0466709_046358 | 3300042648 | Bacteria | 3203 |
| 68 | Ga0466693_343356 | 3300042592 | Bacteria | 6809 |
| 69 | Ga0466691_058054 | 3300042593 | Bacteria | 1822 |
| 70 | Ga0466694_159200 | 3300042594 | Unclassified | 2242 |
| 71 | Ga0466695_183037 | 3300042595 | Bacteria | 8571 |
| 72 | JGI24698J34947_10001714 | 3300002449 | Bacteria | 11675 |
| 73 | Ga0466705_263550 | 3300042612 | Bacteria | 16833 |
| 74 | Ga0123353_10545691 | 3300010167 | Bacteria | 1674 |
| 75 | Ga0123353_10592433 | 3300010167 | Bacteria | 1587 |
| 76 | Ga0123353_11028598 | 3300010167 | Bacteria | 1103 |
| 77 | Ga0123353_11167624 | 3300010167 | Bacteria | 1014 |
| 78 | Ga0466711_171789 | 3300042615 | Bacteria | 6304 |
| 79 | Ga0466715_414728 | 3300042616 | Bacteria | 1427 |
| 80 | Ga0466718_010291 | 3300042617 | Bacteria | 1362 |
| 81 | Ga0466718_127252 | 3300042617 | Bacteria | 1255 |
| 82 | Ga0466723_074492 | 3300042618 | Bacteria | 27779 |
| 83 | Ga0466728_115821 | 3300042620 | Bacteria | 5427 |
| 84 | Ga0466707_116260 | 3300042601 | Bacteria | 1061 |
| 85 | Ga0466707_406614 | 3300042601 | Bacteria | 1037 |
| 86 | Ga0466716_146436 | 3300042605 | Bacteria | 9076 |
| 87 | Ga0466691_097975 | 3300042593 | Bacteria | 9703 |
| 88 | Ga0466694_176447 | 3300042594 | Bacteria | 2577 |
| 89 | Ga0466694_328427 | 3300042594 | Bacteria | 2070 |
| 90 | Ga0466696_392029 | 3300042596 | Bacteria | 16619 |
| 91 | JGI24695J34938_10034974 | 3300002450 | Bacteria | 2301 |
| 92 | Ga0466733_038014 | 3300042659 | Bacteria | 1268 |
| 93 | Ga0466733_147535 | 3300042659 | Bacteria | 34154 |
| 94 | Ga0466733_181670 | 3300042659 | Bacteria | 2553 |
| 95 | Ga0123356_10152410 | 3300010049 | Bacteria | 2297 |
| 96 | Ga0123353_10267676 | 3300010167 | Bacteria | 2635 |
| 97 | Ga0466712_115137 | 3300042614 | Bacteria | 7486 |
| 98 | Ga0466726_389729 | 3300042619 | Bacteria | 2575 |
| 99 | Ga0466728_017645 | 3300042620 | Unclassified | 1156 |
| 100 | Ga0466707_086383 | 3300042601 | Bacteria | 1551 |
| 101 | Ga0466704_297018 | 3300042643 | Bacteria | 13882 |
| 102 | Ga0466696_175819 | 3300042596 | Bacteria | 19045 |
| 103 | JGI24698J34947_10005929 | 3300002449 | Unclassified | 6702 |
| 104 | JGI24698J34947_10009765 | 3300002449 | Bacteria | 5261 |
| 105 | Ga0123357_10001571 | 3300009784 | Bacteria | 24387 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.