Protein Family IF04789
Metagenome
Isolate
178
Members
39
Samples
169
Scaffolds
214.66
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_267684|Ga0466693_267684_617_1228
- Length
- 203 aa
- Sequence
- MKGAGVLSDTELLQAMIGSGGKGNDCRQIAENLNAVIKKIHIENLTIDNVKSVKGIGDAKATVVFAALEFWRRKFATQPQSQITSVEEAVKHLAFIKNEKKKHFLVITLDGARRLIKTHKIPIGARLSHVHPREVFALAIEDRAASIIAAHNNTNGSLKISGEDRETIKLIRKAGELLGITLDDHIIIAGDRFDSIMYPRGNE
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Kalotermitidae
28.2%
Unclassified
23.1%
Rhinotermitidae
2.6%
Termopsidae
2.6%
Taxonomy
Archaea
1
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 4 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 5 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 6 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 35 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_054861 | 3300042606 | Bacteria | 4637 |
| 2 | Ga0466721_099438 | 3300042608 | Bacteria | 2309 |
| 3 | Ga0466721_251559 | 3300042608 | Unclassified | 1761 |
| 4 | Ga0415639_022181 | 3300038395 | Bacteria | 2874 |
| 5 | Ga0466690_012812 | 3300042590 | Bacteria | 135814 |
| 6 | Ga0123355_10134638 | 3300009826 | Bacteria | 3797 |
| 7 | Ga0123356_10001434 | 3300010049 | Bacteria | 26353 |
| 8 | Ga0123356_10007478 | 3300010049 | Bacteria | 10899 |
| 9 | Ga0123356_10031567 | 3300010049 | Bacteria | 4956 |
| 10 | Ga0123356_10184524 | 3300010049 | Bacteria | 2111 |
| 11 | Ga0123356_10456138 | 3300010049 | Bacteria | 1427 |
| 12 | Ga0123356_10544756 | 3300010049 | Bacteria | 1321 |
| 13 | Ga0123353_10078218 | 3300010167 | Bacteria | 5316 |
| 14 | Ga0123353_10394380 | 3300010167 | Bacteria | 2063 |
| 15 | Ga0123353_10879308 | 3300010167 | Bacteria | 1223 |
| 16 | Ga0123353_11147605 | 3300010167 | Unclassified | 1026 |
| 17 | JGI24702J35022_10191720 | 3300002462 | Bacteria | 1166 |
| 18 | Ga0466731_141103 | 3300042622 | Bacteria | 3346 |
| 19 | Ga0466656_011378 | 3300042550 | Bacteria | 5066 |
| 20 | Ga0466694_028284 | 3300042594 | Bacteria | 4899 |
| 21 | Ga0123357_10055023 | 3300009784 | Bacteria | 5361 |
| 22 | Ga0123356_10073166 | 3300010049 | Bacteria | 3222 |
| 23 | Ga0123356_10963944 | 3300010049 | Bacteria | 1023 |
| 24 | Ga0123356_11488750 | 3300010049 | Bacteria | 835 |
| 25 | Ga0123356_11656833 | 3300010049 | Bacteria | 793 |
| 26 | Ga0123353_10257437 | 3300010167 | Bacteria | 2698 |
| 27 | Ga0123353_10475963 | 3300010167 | Bacteria | 1829 |
| 28 | Ga0123353_10666257 | 3300010167 | Bacteria | 1469 |
| 29 | Ga0123353_10941677 | 3300010167 | Bacteria | 1170 |
| 30 | Ga0123354_10141841 | 3300010882 | Bacteria | 2967 |
| 31 | Ga0123354_10261934 | 3300010882 | Bacteria | 1724 |
| 32 | JGI24702J35022_10051284 | 3300002462 | Bacteria | 2199 |
| 33 | JGI24705J35276_12232389 | 3300002504 | Bacteria | 4311 |
| 34 | Ga0466715_600293 | 3300042616 | Bacteria | 5723 |
| 35 | Ga0466729_136661 | 3300042621 | Bacteria | 1944 |
| 36 | Ga0466721_250261 | 3300042608 | Bacteria | 1806 |
| 37 | Ga0466693_267684 | 3300042592 | Bacteria | 1669 |
| 38 | Ga0466694_403488 | 3300042594 | Bacteria | 6007 |
| 39 | Ga0123355_10000314 | 3300009826 | Bacteria | 62371 |
| 40 | Ga0123355_10016444 | 3300009826 | Bacteria | 11658 |
| 41 | Ga0123356_10000230 | 3300010049 | Bacteria | 65093 |
| 42 | Ga0123356_10215708 | 3300010049 | Bacteria | 1972 |
| 43 | Ga0123356_10670759 | 3300010049 | Bacteria | 1205 |
| 44 | Ga0123353_10001276 | 3300010167 | Bacteria | 30871 |
| 45 | Ga0123353_10115700 | 3300010167 | Bacteria | 4316 |
| 46 | Ga0123353_10132567 | 3300010167 | Bacteria | 3998 |
| 47 | Ga0123353_10314947 | 3300010167 | Bacteria | 2379 |
| 48 | Ga0123353_10344201 | 3300010167 | Bacteria | 2250 |
| 49 | Ga0123353_10360010 | 3300010167 | Bacteria | 2187 |
| 50 | Ga0123354_10107810 | 3300010882 | Bacteria | 3706 |
| 51 | JGI24702J35022_10002896 | 3300002462 | Bacteria | 10390 |
| 52 | JGI24702J35022_10230441 | 3300002462 | Bacteria | 1071 |
| 53 | Ga0466721_105224 | 3300042608 | Bacteria | 38043 |
| 54 | Ga0466721_152689 | 3300042608 | Unclassified | 2930 |
| 55 | Ga0415639_001518 | 3300038395 | Bacteria | 1786 |
| 56 | Ga0415639_003007 | 3300038395 | Bacteria | 2835 |
| 57 | Ga0415639_022164 | 3300038395 | Bacteria | 2535 |
| 58 | Ga0123355_10000170 | 3300009826 | Bacteria | 79328 |
| 59 | Ga0123355_10092017 | 3300009826 | Bacteria | 4806 |
| 60 | Ga0123355_10498443 | 3300009826 | Unclassified | 1504 |
| 61 | Ga0123355_10583446 | 3300009826 | Bacteria | 1335 |
| 62 | Ga0123356_10002905 | 3300010049 | Bacteria | 18141 |
| 63 | Ga0123356_10018600 | 3300010049 | Bacteria | 6594 |
| 64 | Ga0123356_10020637 | 3300010049 | Bacteria | 6231 |
| 65 | Ga0123356_10033351 | 3300010049 | Bacteria | 4815 |
| 66 | Ga0123356_10038013 | 3300010049 | Bacteria | 4487 |
| 67 | Ga0123356_10074668 | 3300010049 | Bacteria | 3191 |
| 68 | Ga0123356_10095295 | 3300010049 | Bacteria | 2845 |
| 69 | Ga0123356_10504887 | 3300010049 | Bacteria | 1366 |
| 70 | Ga0123353_10039244 | 3300010167 | Bacteria | 7451 |
| 71 | Ga0123353_10422239 | 3300010167 | Bacteria | 1975 |
| 72 | Ga0123353_10576275 | 3300010167 | Bacteria | 1616 |
| 73 | Ga0123353_10647394 | 3300010167 | Bacteria | 1497 |
| 74 | Ga0123353_11301030 | 3300010167 | Bacteria | 944 |
| 75 | Ga0123353_11993799 | 3300010167 | Bacteria | 711 |
| 76 | JGI24702J35022_10013215 | 3300002462 | Bacteria | 4576 |
| 77 | JGI24705J35276_12198354 | 3300002504 | Bacteria | 1568 |
| 78 | Ga0466702_198750 | 3300042635 | Bacteria | 2326 |
| 79 | Ga0466703_114190 | 3300042636 | Unclassified | 3295 |
| 80 | Ga0466713_114646 | 3300042602 | Bacteria | 6795 |
| 81 | Ga0466719_097342 | 3300042606 | Bacteria | 4053 |
| 82 | Ga0415639_033910 | 3300038395 | Bacteria | 2777 |
| 83 | Ga0415639_172661 | 3300038395 | Bacteria | 4585 |
| 84 | Ga0466690_111138 | 3300042590 | Bacteria | 2990 |
| 85 | Ga0123355_10225630 | 3300009826 | Bacteria | 2685 |
| 86 | Ga0123356_10000241 | 3300010049 | Bacteria | 62989 |
| 87 | Ga0123356_10000932 | 3300010049 | Bacteria | 32321 |
| 88 | Ga0123356_10007670 | 3300010049 | Bacteria | 10751 |
| 89 | Ga0123356_10504641 | 3300010049 | Bacteria | 1366 |
| 90 | Ga0123356_10700196 | 3300010049 | Bacteria | 1182 |
| 91 | Ga0123356_11024877 | 3300010049 | Bacteria | 995 |
| 92 | Ga0123353_10450329 | 3300010167 | Bacteria | 1895 |
| 93 | Ga0123353_10650212 | 3300010167 | Bacteria | 1493 |
| 94 | Ga0123353_10777235 | 3300010167 | Unclassified | 1327 |
| 95 | Ga0123353_11209345 | 3300010167 | Bacteria | 991 |
| 96 | JGI24702J35022_10000013 | 3300002462 | Bacteria | 68740 |
| 97 | JGI24702J35022_10031298 | 3300002462 | Bacteria | 2851 |
| 98 | Ga0466715_567128 | 3300042616 | Bacteria | 3365 |
| 99 | Ga0466728_105852 | 3300042620 | Bacteria | 7246 |
| 100 | Ga0466702_351566 | 3300042635 | Bacteria | 2435 |
| 101 | Ga0466703_209913 | 3300042636 | Bacteria | 1124 |
| 102 | Ga0466703_365559 | 3300042636 | Bacteria | 1084 |
| 103 | Ga0466727_236587 | 3300042655 | Bacteria | 1405 |
| 104 | Ga0466705_087646 | 3300042612 | Bacteria | 15589 |
| 105 | Ga0466717_081401 | 3300042604 | Bacteria | 1195 |
| 106 | Ga0466717_252629 | 3300042604 | Bacteria | 11409 |
| 107 | Ga0466721_071121 | 3300042608 | Bacteria | 18194 |
| 108 | Ga0466698_326514 | 3300042610 | Bacteria | 1493 |
| 109 | Ga0415639_027888 | 3300038395 | Bacteria | 5081 |
| 110 | Ga0466693_255839 | 3300042592 | Bacteria | 1492 |
| 111 | Ga0123356_10014433 | 3300010049 | Bacteria | 7596 |
| 112 | Ga0123356_10014789 | 3300010049 | Bacteria | 7493 |
| 113 | Ga0123356_10041865 | 3300010049 | Bacteria | 4268 |
| 114 | Ga0123356_10044446 | 3300010049 | Bacteria | 4135 |
| 115 | Ga0123356_10066737 | 3300010049 | Bacteria | 3369 |
| 116 | Ga0123356_10067473 | 3300010049 | Bacteria | 3350 |
| 117 | Ga0123356_10719294 | 3300010049 | Bacteria | 1168 |
| 118 | Ga0123356_10742363 | 3300010049 | Bacteria | 1152 |
| 119 | Ga0123353_10004835 | 3300010167 | Bacteria | 17501 |
| 120 | Ga0123353_10025768 | 3300010167 | Bacteria | 8968 |
| 121 | Ga0123353_10044574 | 3300010167 | Bacteria | 7032 |
| 122 | Ga0123353_10045121 | 3300010167 | Bacteria | 6992 |
| 123 | Ga0123353_10107632 | 3300010167 | Bacteria | 4492 |
| 124 | Ga0123353_10241969 | 3300010167 | Bacteria | 2803 |
| 125 | Ga0123353_10309847 | 3300010167 | Bacteria | 2404 |
| 126 | Ga0123353_10878416 | 3300010167 | Bacteria | 1224 |
| 127 | Ga0123353_11890243 | 3300010167 | Bacteria | 737 |
| 128 | Ga0123354_10301475 | 3300010882 | Bacteria | 1515 |
| 129 | Ga0466715_283586 | 3300042616 | Bacteria | 1745 |
| 130 | Ga0466723_371260 | 3300042618 | Bacteria | 3793 |
| 131 | Ga0466708_298627 | 3300042652 | Bacteria | 14488 |
| 132 | Ga0466721_038554 | 3300042608 | Bacteria | 1410 |
| 133 | Ga0466697_011640 | 3300042611 | Bacteria | 1109 |
| 134 | Ga0466696_504484 | 3300042596 | Bacteria | 4503 |
| 135 | Ga0123356_10008166 | 3300010049 | Bacteria | 10417 |
| 136 | Ga0123356_10047394 | 3300010049 | Unclassified | 3999 |
| 137 | Ga0123356_10080838 | 3300010049 | Bacteria | 3073 |
| 138 | Ga0123356_10187772 | 3300010049 | Bacteria | 2095 |
| 139 | Ga0123356_10430300 | 3300010049 | Archaea | 1464 |
| 140 | Ga0123356_10453804 | 3300010049 | Bacteria | 1430 |
| 141 | Ga0123356_10885411 | 3300010049 | Bacteria | 1064 |
| 142 | Ga0123356_11107715 | 3300010049 | Bacteria | 960 |
| 143 | Ga0123353_10333659 | 3300010167 | Bacteria | 2294 |
| 144 | Ga0123353_10650001 | 3300010167 | Bacteria | 1493 |
| 145 | Ga0123353_10956827 | 3300010167 | Bacteria | 1157 |
| 146 | Ga0466711_490613 | 3300042615 | Bacteria | 23403 |
| 147 | Ga0466723_017824 | 3300042618 | Bacteria | 14471 |
| 148 | Ga0466702_132124 | 3300042635 | Bacteria | 13209 |
| 149 | Ga0466704_124289 | 3300042643 | Bacteria | 5897 |
| 150 | Ga0415639_052848 | 3300038395 | Bacteria | 2978 |
| 151 | Ga0415639_064682 | 3300038395 | Bacteria | 1509 |
| 152 | Ga0123355_10000702 | 3300009826 | Bacteria | 45395 |
| 153 | Ga0123355_10049142 | 3300009826 | Bacteria | 6859 |
| 154 | Ga0123355_11301509 | 3300009826 | Bacteria | 729 |
| 155 | Ga0123356_10000142 | 3300010049 | Bacteria | 81248 |
| 156 | Ga0123356_10016678 | 3300010049 | Bacteria | 7005 |
| 157 | Ga0123356_10017498 | 3300010049 | Bacteria | 6819 |
| 158 | Ga0123356_10057396 | 3300010049 | Bacteria | 3629 |
| 159 | Ga0123356_10260560 | 3300010049 | Unclassified | 1817 |
| 160 | Ga0123356_10269457 | 3300010049 | Bacteria | 1792 |
| 161 | Ga0123356_10277479 | 3300010049 | Bacteria | 1769 |
| 162 | Ga0123356_11067151 | 3300010049 | Bacteria | 977 |
| 163 | Ga0123353_10280151 | 3300010167 | Bacteria | 2561 |
| 164 | Ga0123353_10293141 | 3300010167 | Bacteria | 2489 |
| 165 | Ga0123353_10519561 | 3300010167 | Bacteria | 1728 |
| 166 | Ga0123353_11772131 | 3300010167 | Bacteria | 769 |
| 167 | Ga0123354_10288593 | 3300010882 | Bacteria | 1577 |
| 168 | Ga0123354_10577212 | 3300010882 | Bacteria | 835 |
| 169 | Ga0466723_100716 | 3300042618 | Bacteria | 22662 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.