Protein Family IF04784
Metagenome
Isolate
245
Members
66
Samples
229
Scaffolds
138.78
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_206784|Ga0466693_206784_2559_3074
- Length
- 171 aa
- Sequence
- VYLQGIGGFCLLYWLHVITLFYNTTEQGAKSEKMNSYRKELRFHTKTRRAYINITPQVEDALAESGIREGLCLVNAMNITASVFINDNESGLHQDFERWLEKLAPEKPHDQYEHNGYEDNADAHLKRSVMGREVVVAVTDGKLDFGTWEQIFYGEFDGKRDKRVLVKIIGE
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Unclassified
26.2%
Kalotermitidae
21.5%
Rhinotermitidae
4.6%
Termopsidae
3.1%
Passalidae
1.5%
Taxonomy
Archaea
1
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 16 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 42 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 47 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 48 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 53 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 54 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 55 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 56 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 57 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 59 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 60 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 61 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_102908 | 3300042612 | Bacteria | 2745 |
| 2 | Ga0466705_188192 | 3300042612 | Bacteria | 7765 |
| 3 | Ga0466733_110752 | 3300042659 | Bacteria | 3499 |
| 4 | Ga0415639_241646 | 3300038395 | Bacteria | 2649 |
| 5 | Ga0466691_001608 | 3300042593 | Bacteria | 7854 |
| 6 | Ga0466696_396713 | 3300042596 | Bacteria | 1470 |
| 7 | Ga0466702_138280 | 3300042635 | Bacteria | 1879 |
| 8 | Ga0466709_121927 | 3300042648 | Bacteria | 2231 |
| 9 | Ga0466725_026066 | 3300042654 | Bacteria | 1190 |
| 10 | Ga0466700_336827 | 3300042600 | Unclassified | 1684 |
| 11 | Ga0466707_246626 | 3300042601 | Bacteria | 1455 |
| 12 | Ga0466707_371884 | 3300042601 | Unclassified | 1426 |
| 13 | Ga0466714_019707 | 3300042603 | Bacteria | 2248 |
| 14 | Ga0466714_071980 | 3300042603 | Bacteria | 2824 |
| 15 | Ga0466721_163316 | 3300042608 | Bacteria | 24030 |
| 16 | Ga0123357_10049393 | 3300009784 | Bacteria | 5697 |
| 17 | Ga0123356_11348623 | 3300010049 | Bacteria | 875 |
| 18 | Ga0123353_10134504 | 3300010167 | Bacteria | 3966 |
| 19 | Ga0123353_10202486 | 3300010167 | Bacteria | 3122 |
| 20 | Ga0123353_10257646 | 3300010167 | Bacteria | 2697 |
| 21 | Ga0123353_10825343 | 3300010167 | Bacteria | 1275 |
| 22 | Ga0123353_11476528 | 3300010167 | Bacteria | 868 |
| 23 | Ga0123353_12191046 | 3300010167 | Bacteria | 669 |
| 24 | Ga0123353_12566499 | 3300010167 | Bacteria | 604 |
| 25 | Ga0123353_12703987 | 3300010167 | Unclassified | 584 |
| 26 | JGI24702J35022_10031061 | 3300002462 | Bacteria | 2864 |
| 27 | Ga0466711_164179 | 3300042615 | Bacteria | 20323 |
| 28 | Ga0466726_327735 | 3300042619 | Bacteria | 3769 |
| 29 | Ga0466705_196403 | 3300042612 | Bacteria | 2934 |
| 30 | Ga0466692_107906 | 3300042591 | Unclassified | 2422 |
| 31 | Ga0466693_206784 | 3300042592 | Bacteria | 3318 |
| 32 | Ga0466699_009102 | 3300042597 | Bacteria | 1539 |
| 33 | Ga0466731_302375 | 3300042622 | Bacteria | 3815 |
| 34 | Ga0466702_251663 | 3300042635 | Bacteria | 1789 |
| 35 | Ga0466700_010160 | 3300042600 | Bacteria | 1658 |
| 36 | Ga0466717_070954 | 3300042604 | Bacteria | 6625 |
| 37 | Ga0466716_379717 | 3300042605 | Bacteria | 1600 |
| 38 | Ga0466722_116866 | 3300042609 | Bacteria | 4419 |
| 39 | Ga0123357_10793381 | 3300009784 | Bacteria | 643 |
| 40 | Ga0123353_10191863 | 3300010167 | Bacteria | 3224 |
| 41 | Ga0123353_10671513 | 3300010167 | Bacteria | 1462 |
| 42 | JGI24705J35276_12234739 | 3300002504 | Bacteria | 5790 |
| 43 | Ga0466705_485611 | 3300042612 | Bacteria | 1187 |
| 44 | Ga0466712_019344 | 3300042614 | Bacteria | 3151 |
| 45 | Ga0466711_411974 | 3300042615 | Bacteria | 3720 |
| 46 | Ga0466711_435094 | 3300042615 | Bacteria | 3970 |
| 47 | Ga0466715_104453 | 3300042616 | Unclassified | 1468 |
| 48 | Ga0466715_482546 | 3300042616 | Bacteria | 5198 |
| 49 | Ga0466715_633157 | 3300042616 | Unclassified | 14824 |
| 50 | Ga0466723_168788 | 3300042618 | Bacteria | 3056 |
| 51 | Ga0466726_047932 | 3300042619 | Bacteria | 5401 |
| 52 | Ga0466705_002597 | 3300042612 | Bacteria | 1136 |
| 53 | Ga0466729_234360 | 3300042621 | Bacteria | 2069 |
| 54 | Ga0466703_147234 | 3300042636 | Bacteria | 1079 |
| 55 | Ga0466727_012959 | 3300042655 | Bacteria | 3189 |
| 56 | Ga0466707_080884 | 3300042601 | Unclassified | 1336 |
| 57 | Ga0466707_421272 | 3300042601 | Unclassified | 1426 |
| 58 | Ga0466714_012595 | 3300042603 | Bacteria | 16106 |
| 59 | Ga0466714_116981 | 3300042603 | Bacteria | 4366 |
| 60 | Ga0466716_120567 | 3300042605 | Unclassified | 1001 |
| 61 | Ga0466722_167292 | 3300042609 | Bacteria | 1112 |
| 62 | Ga0466722_262244 | 3300042609 | Unclassified | 2508 |
| 63 | Ga0123357_10081718 | 3300009784 | Bacteria | 4246 |
| 64 | Ga0123355_10115766 | 3300009826 | Bacteria | 4174 |
| 65 | Ga0123356_11106733 | 3300010049 | Bacteria | 960 |
| 66 | Ga0123353_10261913 | 3300010167 | Bacteria | 2670 |
| 67 | Ga0123353_10491229 | 3300010167 | Bacteria | 1792 |
| 68 | Ga0123353_10529814 | 3300010167 | Unclassified | 1706 |
| 69 | Ga0123353_10946714 | 3300010167 | Bacteria | 1165 |
| 70 | Ga0123353_11001122 | 3300010167 | Bacteria | 1123 |
| 71 | Ga0123354_10055603 | 3300010882 | Bacteria | 5918 |
| 72 | Ga0123354_10191645 | 3300010882 | Bacteria | 2286 |
| 73 | JGI24696J40584_12666421 | 3300002834 | Unclassified | 707 |
| 74 | Ga0466715_340837 | 3300042616 | Bacteria | 1861 |
| 75 | Ga0466705_340998 | 3300042612 | Unclassified | 1204 |
| 76 | Ga0466690_201474 | 3300042590 | Bacteria | 2412 |
| 77 | Ga0466692_046216 | 3300042591 | Bacteria | 6661 |
| 78 | Ga0466696_159699 | 3300042596 | Bacteria | 1128 |
| 79 | Ga0466696_218928 | 3300042596 | Bacteria | 1299 |
| 80 | Ga0466701_009425 | 3300042598 | Bacteria | 1467 |
| 81 | Ga0466704_039769 | 3300042643 | Bacteria | 1620 |
| 82 | Ga0466708_160959 | 3300042652 | Bacteria | 46068 |
| 83 | Ga0466708_416040 | 3300042652 | Bacteria | 55144 |
| 84 | Ga0466700_363129 | 3300042600 | Bacteria | 2758 |
| 85 | Ga0466707_233867 | 3300042601 | Unclassified | 1413 |
| 86 | Ga0466714_039649 | 3300042603 | Bacteria | 3785 |
| 87 | Ga0466717_036493 | 3300042604 | Bacteria | 1381 |
| 88 | Ga0466717_301160 | 3300042604 | Bacteria | 1068 |
| 89 | Ga0466716_245178 | 3300042605 | Bacteria | 1098 |
| 90 | Ga0466722_176253 | 3300042609 | Unclassified | 7741 |
| 91 | Ga0466698_257874 | 3300042610 | Bacteria | 2734 |
| 92 | Ga0123357_10314851 | 3300009784 | Bacteria | 1556 |
| 93 | Ga0123355_10349921 | 3300009826 | Bacteria | 1958 |
| 94 | Ga0123356_11005302 | 3300010049 | Bacteria | 1004 |
| 95 | Ga0123356_12547778 | 3300010049 | Bacteria | 640 |
| 96 | Ga0123353_10000530 | 3300010167 | Bacteria | 47241 |
| 97 | Ga0123353_10691350 | 3300010167 | Bacteria | 1434 |
| 98 | Ga0123353_11122485 | 3300010167 | Bacteria | 1041 |
| 99 | Ga0123353_11186888 | 3300010167 | Bacteria | 1003 |
| 100 | Ga0123353_11544085 | 3300010167 | Bacteria | 842 |
| 101 | Ga0123353_12487132 | 3300010167 | Bacteria | 616 |
| 102 | JGI24702J35022_10479878 | 3300002462 | Unclassified | 760 |
| 103 | JGI24705J35276_12226708 | 3300002504 | Bacteria | 2894 |
| 104 | Ga0072940_1261123 | 3300005200 | Bacteria | 4152 |
| 105 | Ga0466711_146120 | 3300042615 | Unclassified | 11435 |
| 106 | Ga0466726_114588 | 3300042619 | Bacteria | 3616 |
| 107 | Ga0466705_238350 | 3300042612 | Bacteria | 1617 |
| 108 | Ga0466692_127950 | 3300042591 | Bacteria | 3316 |
| 109 | Ga0466691_034226 | 3300042593 | Bacteria | 4646 |
| 110 | Ga0466694_150725 | 3300042594 | Unclassified | 1401 |
| 111 | Ga0466696_139409 | 3300042596 | Bacteria | 2559 |
| 112 | Ga0466734_023029 | 3300042623 | Bacteria | 1088 |
| 113 | Ga0466702_132743 | 3300042635 | Bacteria | 5884 |
| 114 | Ga0466702_344118 | 3300042635 | Unclassified | 1482 |
| 115 | Ga0466703_003148 | 3300042636 | Bacteria | 15239 |
| 116 | Ga0466703_090265 | 3300042636 | Unclassified | 1777 |
| 117 | Ga0466703_127259 | 3300042636 | Unclassified | 10365 |
| 118 | Ga0466704_424986 | 3300042643 | Bacteria | 1631 |
| 119 | Ga0466704_468216 | 3300042643 | Bacteria | 2259 |
| 120 | Ga0466708_062966 | 3300042652 | Bacteria | 6254 |
| 121 | Ga0466713_010199 | 3300042602 | Bacteria | 24215 |
| 122 | Ga0466719_423702 | 3300042606 | Bacteria | 3538 |
| 123 | Ga0466698_416519 | 3300042610 | Bacteria | 4943 |
| 124 | Ga0123355_10244190 | 3300009826 | Bacteria | 2538 |
| 125 | Ga0123355_10306424 | 3300009826 | Bacteria | 2158 |
| 126 | Ga0123355_10316520 | 3300009826 | Bacteria | 2108 |
| 127 | Ga0123355_10402846 | 3300009826 | Bacteria | 1763 |
| 128 | Ga0123355_11657900 | 3300009826 | Archaea | 612 |
| 129 | Ga0123356_10687037 | 3300010049 | Bacteria | 1192 |
| 130 | Ga0123356_11211808 | 3300010049 | Bacteria | 921 |
| 131 | Ga0123353_10610371 | 3300010167 | Bacteria | 1556 |
| 132 | Ga0123353_11226300 | 3300010167 | Bacteria | 982 |
| 133 | Ga0123353_11660870 | 3300010167 | Bacteria | 803 |
| 134 | Ga0123353_11717524 | 3300010167 | Bacteria | 785 |
| 135 | Ga0123353_12189554 | 3300010167 | Bacteria | 669 |
| 136 | JGI24698J34947_10164943 | 3300002449 | Unclassified | 903 |
| 137 | JGI24695J34938_10007118 | 3300002450 | Bacteria | 6609 |
| 138 | Ga0466712_162772 | 3300042614 | Bacteria | 6399 |
| 139 | Ga0466711_156592 | 3300042615 | Unclassified | 1335 |
| 140 | Ga0466715_031564 | 3300042616 | Bacteria | 2692 |
| 141 | Ga0466715_118161 | 3300042616 | Bacteria | 10989 |
| 142 | Ga0466723_011556 | 3300042618 | Bacteria | 4100 |
| 143 | Ga0466723_062200 | 3300042618 | Bacteria | 5825 |
| 144 | Ga0466728_399277 | 3300042620 | Bacteria | 1245 |
| 145 | Ga0466705_357597 | 3300042612 | Unclassified | 49325 |
| 146 | Ga0466696_058452 | 3300042596 | Bacteria | 1824 |
| 147 | Ga0466696_285118 | 3300042596 | Bacteria | 2496 |
| 148 | Ga0466703_406136 | 3300042636 | Bacteria | 1520 |
| 149 | Ga0466704_072400 | 3300042643 | Bacteria | 3908 |
| 150 | Ga0466709_291169 | 3300042648 | Unclassified | 13539 |
| 151 | Ga0466725_285300 | 3300042654 | Bacteria | 1283 |
| 152 | Ga0466700_217728 | 3300042600 | Bacteria | 5203 |
| 153 | Ga0466717_113123 | 3300042604 | Bacteria | 2716 |
| 154 | Ga0466719_036252 | 3300042606 | Bacteria | 1872 |
| 155 | Ga0466719_126659 | 3300042606 | Unclassified | 1251 |
| 156 | Ga0466721_184800 | 3300042608 | Bacteria | 2091 |
| 157 | Ga0466722_136630 | 3300042609 | Bacteria | 10654 |
| 158 | Ga0123356_13651819 | 3300010049 | Unclassified | 532 |
| 159 | Ga0123353_10050608 | 3300010167 | Bacteria | 6625 |
| 160 | Ga0123353_10081348 | 3300010167 | Bacteria | 5208 |
| 161 | Ga0123353_11205505 | 3300010167 | Bacteria | 993 |
| 162 | Ga0123353_12476334 | 3300010167 | Bacteria | 618 |
| 163 | Ga0123353_13358411 | 3300010167 | Bacteria | 509 |
| 164 | Ga0123354_10148654 | 3300010882 | Bacteria | 2852 |
| 165 | IMNBL1DRAFT_c0015823 | 3300000062 | Bacteria | 3253 |
| 166 | JGI24702J35022_10045849 | 3300002462 | Bacteria | 2329 |
| 167 | JGI24702J35022_10130313 | 3300002462 | Unclassified | 1396 |
| 168 | Ga0466715_320519 | 3300042616 | Bacteria | 1817 |
| 169 | Ga0466723_330035 | 3300042618 | Bacteria | 1856 |
| 170 | Ga0466726_258021 | 3300042619 | Unclassified | 2094 |
| 171 | Ga0466728_079416 | 3300042620 | Bacteria | 1067 |
| 172 | Ga0466691_045908 | 3300042593 | Bacteria | 6354 |
| 173 | Ga0466694_054381 | 3300042594 | Unclassified | 3066 |
| 174 | Ga0466696_230505 | 3300042596 | Bacteria | 1975 |
| 175 | Ga0466731_265375 | 3300042622 | Bacteria | 1500 |
| 176 | Ga0466702_226014 | 3300042635 | Bacteria | 1417 |
| 177 | Ga0466709_182354 | 3300042648 | Unclassified | 1617 |
| 178 | Ga0466709_219282 | 3300042648 | Bacteria | 2942 |
| 179 | Ga0466709_300839 | 3300042648 | Bacteria | 27069 |
| 180 | Ga0466707_313137 | 3300042601 | Bacteria | 1894 |
| 181 | Ga0466713_065312 | 3300042602 | Bacteria | 73523 |
| 182 | Ga0466714_071865 | 3300042603 | Unclassified | 1334 |
| 183 | Ga0466714_169535 | 3300042603 | Bacteria | 7299 |
| 184 | Ga0466716_070440 | 3300042605 | Bacteria | 1463 |
| 185 | Ga0466722_072961 | 3300042609 | Bacteria | 1240 |
| 186 | Ga0466722_101174 | 3300042609 | Unclassified | 1154 |
| 187 | Ga0466722_147070 | 3300042609 | Bacteria | 3236 |
| 188 | Ga0123355_10298162 | 3300009826 | Bacteria | 2202 |
| 189 | Ga0123353_10249341 | 3300010167 | Bacteria | 2751 |
| 190 | Ga0123353_10435393 | 3300010167 | Bacteria | 1937 |
| 191 | Ga0123353_10450973 | 3300010167 | Bacteria | 1894 |
| 192 | Ga0123354_10454675 | 3300010882 | Unclassified | 1034 |
| 193 | Ga0466715_432101 | 3300042616 | Unclassified | 11832 |
| 194 | Ga0466723_092988 | 3300042618 | Bacteria | 1086 |
| 195 | Ga0466723_114140 | 3300042618 | Bacteria | 1693 |
| 196 | Ga0466723_166325 | 3300042618 | Bacteria | 59473 |
| 197 | Ga0466723_317391 | 3300042618 | Bacteria | 1395 |
| 198 | Ga0466726_010360 | 3300042619 | Bacteria | 5285 |
| 199 | Ga0466729_130397 | 3300042621 | Unclassified | 7674 |
| 200 | Ga0466733_219294 | 3300042659 | Bacteria | 1818 |
| 201 | Ga0466692_078225 | 3300042591 | Bacteria | 14986 |
| 202 | Ga0466692_130062 | 3300042591 | Bacteria | 2258 |
| 203 | Ga0466692_179200 | 3300042591 | Bacteria | 2811 |
| 204 | Ga0466691_020354 | 3300042593 | Unclassified | 4224 |
| 205 | Ga0466699_125535 | 3300042597 | Bacteria | 1582 |
| 206 | Ga0466729_234818 | 3300042621 | Unclassified | 3426 |
| 207 | Ga0466702_340249 | 3300042635 | Unclassified | 1089 |
| 208 | Ga0466725_030978 | 3300042654 | Bacteria | 4688 |
| 209 | Ga0466725_414855 | 3300042654 | Bacteria | 1241 |
| 210 | Ga0466727_106389 | 3300042655 | Bacteria | 11218 |
| 211 | Ga0466707_322823 | 3300042601 | Unclassified | 1949 |
| 212 | Ga0466713_083544 | 3300042602 | Unclassified | 2553 |
| 213 | Ga0466714_097482 | 3300042603 | Unclassified | 1210 |
| 214 | Ga0466719_225776 | 3300042606 | Bacteria | 1222 |
| 215 | Ga0466722_000940 | 3300042609 | Bacteria | 5162 |
| 216 | Ga0123355_10007201 | 3300009826 | Bacteria | 16624 |
| 217 | Ga0123356_10226217 | 3300010049 | Bacteria | 1931 |
| 218 | Ga0123356_10662505 | 3300010049 | Bacteria | 1211 |
| 219 | Ga0123356_12353461 | 3300010049 | Bacteria | 666 |
| 220 | Ga0123353_10981464 | 3300010167 | Bacteria | 1138 |
| 221 | Ga0123353_11869284 | 3300010167 | Bacteria | 742 |
| 222 | Ga0123353_12129070 | 3300010167 | Bacteria | 682 |
| 223 | Ga0123353_13211525 | 3300010167 | Bacteria | 524 |
| 224 | Ga0072941_1042575 | 3300005201 | Bacteria | 5068 |
| 225 | Ga0466712_019444 | 3300042614 | Unclassified | 5071 |
| 226 | Ga0466715_173974 | 3300042616 | Bacteria | 1206 |
| 227 | Ga0466715_628028 | 3300042616 | Bacteria | 3323 |
| 228 | Ga0466729_027003 | 3300042621 | Bacteria | 6385 |
| 229 | Ga0466729_034475 | 3300042621 | Bacteria | 9914 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01894 | UPF0047 | Uncharacterised protein family UPF0047 | 53 | 168 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.