Protein Family IF04776
Metagenome
Isolate
103
Members
40
Samples
100
Scaffolds
139.55
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_152418|Ga0466693_152418_1037_1495
- Length
- 152 aa
- Sequence
- MILQQKFRLFVKMQKVIIDTNVIVSSLIQKSYPHRIVFGLLIEGKILLCISPQLIAEYYAVLTRPKFAQFQEFSVKAKIVLALIEKKAICYIPSIALNLISDKDDNKILELADECTADFVITGNTNDFTFPAYKQTKIVTPRDYWTRYRPAE
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
73.7%
Unclassified
10.5%
Kalotermitidae
7.9%
Rhinotermitidae
5.3%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
93
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_153052 | 3300042656 | Unclassified | 2598 |
| 2 | Ga0123356_10045588 | 3300010049 | Bacteria | 4079 |
| 3 | Ga0123353_10001310 | 3300010167 | Bacteria | 30488 |
| 4 | Ga0123353_11588470 | 3300010167 | Bacteria | 827 |
| 5 | Ga0123354_10459799 | 3300010882 | Bacteria | 1023 |
| 6 | Ga0466720_219088 | 3300042607 | Bacteria | 1111 |
| 7 | Ga0466722_128798 | 3300042609 | Unclassified | 6585 |
| 8 | AustNasuHG_c1044044 | 3300000089 | Bacteria | 1039 |
| 9 | JGI24698J34947_10000901 | 3300002449 | Bacteria | 15066 |
| 10 | JGI24698J34947_10029260 | 3300002449 | Bacteria | 2910 |
| 11 | JGI24702J35022_10036204 | 3300002462 | Bacteria | 2638 |
| 12 | Ga0466724_62288 | 3300042649 | Bacteria | 1838 |
| 13 | Ga0123356_10312531 | 3300010049 | Bacteria | 1681 |
| 14 | Ga0123353_11053175 | 3300010167 | Bacteria | 1086 |
| 15 | Ga0123354_10066601 | 3300010882 | Bacteria | 5257 |
| 16 | AustNasuHG_c1017065 | 3300000089 | Bacteria | 2420 |
| 17 | JGI24698J34947_10012980 | 3300002449 | Unclassified | 4551 |
| 18 | JGI24698J34947_10061660 | 3300002449 | Bacteria | 1844 |
| 19 | JGI24698J34947_10191937 | 3300002449 | Bacteria | 807 |
| 20 | JGI24695J34938_10039009 | 3300002450 | Bacteria | 2148 |
| 21 | Ga0072940_1018775 | 3300005200 | Unclassified | 1440 |
| 22 | Ga0072941_1511407 | 3300005201 | Bacteria | 989 |
| 23 | Ga0466697_237083 | 3300042611 | Bacteria | 1085 |
| 24 | Ga0466732_112112 | 3300042656 | Bacteria | 3384 |
| 25 | Ga0466733_046801 | 3300042659 | Bacteria | 9112 |
| 26 | Ga0466712_259270 | 3300042614 | Bacteria | 1494 |
| 27 | Ga0466728_225844 | 3300042620 | Bacteria | 1130 |
| 28 | Ga0123356_11343597 | 3300010049 | Bacteria | 877 |
| 29 | Ga0123353_11654180 | 3300010167 | Bacteria | 805 |
| 30 | Ga0466701_024428 | 3300042598 | Bacteria | 1849 |
| 31 | Ga0466701_056647 | 3300042598 | Bacteria | 1285 |
| 32 | JGI24698J34947_10058264 | 3300002449 | Unclassified | 1913 |
| 33 | JGI24702J35022_10209912 | 3300002462 | Bacteria | 1118 |
| 34 | JGI24705J35276_12093526 | 3300002504 | Bacteria | 1000 |
| 35 | JGI24696J40584_12961020 | 3300002834 | Bacteria | 10043 |
| 36 | Ga0072941_1001253 | 3300005201 | Bacteria | 34161 |
| 37 | Ga0466712_182729 | 3300042614 | Bacteria | 7226 |
| 38 | Ga0466718_133137 | 3300042617 | Bacteria | 1418 |
| 39 | Ga0466734_008385 | 3300042623 | Bacteria | 1513 |
| 40 | Ga0123356_10030786 | 3300010049 | Bacteria | 5021 |
| 41 | Ga0123356_10190678 | 3300010049 | Bacteria | 2080 |
| 42 | Ga0123356_10294341 | 3300010049 | Bacteria | 1725 |
| 43 | Ga0123356_12050944 | 3300010049 | Bacteria | 714 |
| 44 | Ga0123353_11411333 | 3300010167 | Bacteria | 894 |
| 45 | JGI24705J35276_11996620 | 3300002504 | Bacteria | 843 |
| 46 | JGI24705J35276_12096273 | 3300002504 | Bacteria | 1007 |
| 47 | Ga0072941_1021462 | 3300005201 | Bacteria | 3053 |
| 48 | Ga0466718_019053 | 3300042617 | Bacteria | 3439 |
| 49 | Ga0466729_074782 | 3300042621 | Bacteria | 2276 |
| 50 | Ga0466699_023757 | 3300042597 | Unclassified | 2130 |
| 51 | Ga0466699_053937 | 3300042597 | Bacteria | 1474 |
| 52 | Ga0466701_045240 | 3300042598 | Bacteria | 5701 |
| 53 | Ga0466707_404918 | 3300042601 | Bacteria | 1081 |
| 54 | Ga0466720_107672 | 3300042607 | Unclassified | 2229 |
| 55 | Ga0466721_017633 | 3300042608 | Bacteria | 1092 |
| 56 | AustNasuHG_c1000145 | 3300000089 | Bacteria | 22307 |
| 57 | JGI24698J34947_10102749 | 3300002449 | Bacteria | 1281 |
| 58 | Ga0466712_054931 | 3300042614 | Bacteria | 10395 |
| 59 | Ga0466718_152533 | 3300042617 | Bacteria | 2078 |
| 60 | Ga0466704_446410 | 3300042643 | Bacteria | 12427 |
| 61 | Ga0264413_108937 | 3300024493 | Bacteria | 1586 |
| 62 | Ga0415639_161741 | 3300038395 | Bacteria | 1327 |
| 63 | Ga0466699_173931 | 3300042597 | Bacteria | 1036 |
| 64 | Ga0123357_10226091 | 3300009784 | Bacteria | 2064 |
| 65 | Ga0123356_10847405 | 3300010049 | Bacteria | 1085 |
| 66 | Ga0123353_10464807 | 3300010167 | Bacteria | 1857 |
| 67 | Ga0123354_10596395 | 3300010882 | Bacteria | 811 |
| 68 | Ga0466706_004382 | 3300042599 | Bacteria | 1820 |
| 69 | Ga0466720_068086 | 3300042607 | Bacteria | 12143 |
| 70 | Ga0466722_109898 | 3300042609 | Unclassified | 2278 |
| 71 | JGI24698J34947_10024045 | 3300002449 | Bacteria | 3256 |
| 72 | JGI24705J35276_11989925 | 3300002504 | Bacteria | 835 |
| 73 | Ga0466718_079174 | 3300042617 | Bacteria | 2033 |
| 74 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 75 | Ga0123356_10345420 | 3300010049 | Bacteria | 1610 |
| 76 | Ga0123353_10000486 | 3300010167 | Bacteria | 49107 |
| 77 | Ga0123353_10399332 | 3300010167 | Bacteria | 2047 |
| 78 | Ga0466701_061827 | 3300042598 | Bacteria | 11464 |
| 79 | Ga0466707_072614 | 3300042601 | Bacteria | 1128 |
| 80 | Ga0466717_237898 | 3300042604 | Unclassified | 1569 |
| 81 | Ga0466719_084754 | 3300042606 | Bacteria | 11305 |
| 82 | Ga0466720_001035 | 3300042607 | Bacteria | 1239 |
| 83 | Ga0072940_1398968 | 3300005200 | Bacteria | 642 |
| 84 | Ga0072941_1072552 | 3300005201 | Bacteria | 2237 |
| 85 | Ga0072941_1189841 | 3300005201 | Bacteria | 715 |
| 86 | Ga0466712_028794 | 3300042614 | Bacteria | 2580 |
| 87 | Ga0466731_210883 | 3300042622 | Unclassified | 5788 |
| 88 | Ga0466702_194155 | 3300042635 | Bacteria | 1693 |
| 89 | Ga0264413_107611 | 3300024493 | Bacteria | 1159 |
| 90 | Ga0264413_117976 | 3300024493 | Bacteria | 12307 |
| 91 | Ga0466693_020103 | 3300042592 | Bacteria | 1249 |
| 92 | Ga0466693_152418 | 3300042592 | Bacteria | 2417 |
| 93 | Ga0123356_10160164 | 3300010049 | Bacteria | 2247 |
| 94 | Ga0123353_10788419 | 3300010167 | Bacteria | 1315 |
| 95 | Ga0123353_13341215 | 3300010167 | Bacteria | 511 |
| 96 | Ga0466707_043727 | 3300042601 | Bacteria | 1002 |
| 97 | Ga0466720_066255 | 3300042607 | Bacteria | 4688 |
| 98 | AustNasuHG_c1026065 | 3300000089 | Bacteria | 1827 |
| 99 | JGI24698J34947_10012953 | 3300002449 | Bacteria | 4556 |
| 100 | JGI24698J34947_10077794 | 3300002449 | Bacteria | 1567 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13470 | PIN_3 | PIN domain | 15 | 125 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.