Protein Family IF04760
Metagenome
Isolate
135
Members
48
Samples
130
Scaffolds
488.72
Avg Length
Representative Sequence
- ID
- 3300042592|Ga0466693_069579|Ga0466693_069579_53_1663
- Length
- 536 aa
- Sequence
- MARFKESDITQGQFIAVNLSEQLIPGTFEWTLNYLIERMDLSLFKEKYNNDEKGASAYQPKALLKIILYCYNNGILSSRRMEKACKTNIIVKTLAGDGEPDHATIATFISTNSEEVKDLFVKVLMQCQELNLITGEMVAIDGCKISSNASKEWSGTIEHLKKRKARLEKYVKKIINRHKELDKNNDVKRKQKKYKKTMGDDKERRQRHVDRIEKKLKRLNEFLAEAEPKMGANGKEIMTNVTDPQSAKIKGPHGYIQGYNGITVADSKNQVILCTEAIGFGSESGSFPKMLNRLEENMKKITGKKEPLKDILLEGDTGYFSEENLQEAQNKGIEVIIPDPYFRMRDNIFEERNKTRKKPTRYTAEDFKYNERKNCYTCPWGKILSYKGRVKLRNNEGDKYMASSRDCGICPLAEKCLMKSPRRKEKXXXNRTPKRTLYITVLKHEENLSEKMRKKIDDPAFRELYSRRQQIIEPVFANITRCKGMDRFTLRTAKKINIQWHLYCIVHNIGKCVKPIEEKIRSRWKNKRLSGLLYAT
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
63.0%
Kalotermitidae
19.6%
Termopsidae
8.7%
Unclassified
6.5%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_150001 | 3300042659 | Bacteria | 2048 |
| 2 | Ga0466706_164563 | 3300042599 | Bacteria | 2094 |
| 3 | Ga0466717_193071 | 3300042604 | Bacteria | 1687 |
| 4 | Ga0466699_391438 | 3300042597 | Bacteria | 3432 |
| 5 | Ga0123357_10179920 | 3300009784 | Bacteria | 2473 |
| 6 | Ga0123357_10275042 | 3300009784 | Bacteria | 1751 |
| 7 | Ga0123356_10202507 | 3300010049 | Bacteria | 2026 |
| 8 | Ga0123356_10221703 | 3300010049 | Bacteria | 1948 |
| 9 | Ga0123356_10226118 | 3300010049 | Bacteria | 1932 |
| 10 | Ga0123353_10446223 | 3300010167 | Bacteria | 1907 |
| 11 | Ga0123353_10526899 | 3300010167 | Bacteria | 1712 |
| 12 | JGI24695J34938_10053183 | 3300002450 | Bacteria | 1763 |
| 13 | JGI24702J35022_10019828 | 3300002462 | Bacteria | 3657 |
| 14 | Ga0466734_139687 | 3300042623 | Bacteria | 1939 |
| 15 | Ga0466712_121080 | 3300042614 | Bacteria | 1871 |
| 16 | Ga0466712_131691 | 3300042614 | Bacteria | 1910 |
| 17 | Ga0466711_034328 | 3300042615 | Bacteria | 1446 |
| 18 | Ga0466697_183335 | 3300042611 | Bacteria | 2148 |
| 19 | Ga0466700_161780 | 3300042600 | Bacteria | 1913 |
| 20 | Ga0466707_198908 | 3300042601 | Bacteria | 2105 |
| 21 | Ga0466717_291405 | 3300042604 | Bacteria | 2843 |
| 22 | Ga0466720_094845 | 3300042607 | Bacteria | 1910 |
| 23 | Ga0466693_059581 | 3300042592 | Bacteria | 1816 |
| 24 | Ga0123356_10140653 | 3300010049 | Bacteria | 2380 |
| 25 | Ga0123356_10176511 | 3300010049 | Bacteria | 2153 |
| 26 | Ga0123356_10222193 | 3300010049 | Bacteria | 1946 |
| 27 | Ga0123356_10238639 | 3300010049 | Bacteria | 1887 |
| 28 | JGI24702J35022_10072550 | 3300002462 | Bacteria | 1856 |
| 29 | JGI24702J35022_10080222 | 3300002462 | Bacteria | 1767 |
| 30 | Ga0466731_192735 | 3300042622 | Bacteria | 2636 |
| 31 | Ga0466731_434213 | 3300042622 | Bacteria | 3539 |
| 32 | Ga0466712_015434 | 3300042614 | Archaea | 4949 |
| 33 | Ga0466712_049347 | 3300042614 | Bacteria | 1950 |
| 34 | Ga0466712_084420 | 3300042614 | Bacteria | 3421 |
| 35 | Ga0466712_180913 | 3300042614 | Bacteria | 1809 |
| 36 | Ga0466718_124993 | 3300042617 | Bacteria | 1850 |
| 37 | Ga0466733_031813 | 3300042659 | Bacteria | 4709 |
| 38 | Ga0466700_312047 | 3300042600 | Unclassified | 1922 |
| 39 | Ga0466716_145036 | 3300042605 | Bacteria | 1923 |
| 40 | Ga0466719_242141 | 3300042606 | Bacteria | 3706 |
| 41 | Ga0466721_104830 | 3300042608 | Bacteria | 1791 |
| 42 | Ga0466695_010029 | 3300042595 | Bacteria | 2143 |
| 43 | Ga0466695_033648 | 3300042595 | Bacteria | 2724 |
| 44 | Ga0123356_10184126 | 3300010049 | Bacteria | 2113 |
| 45 | Ga0123353_10408154 | 3300010167 | Bacteria | 2018 |
| 46 | AustNasuHG_c1027569 | 3300000089 | Bacteria | 1728 |
| 47 | JGI24698J34947_10041245 | 3300002449 | Bacteria | 2378 |
| 48 | JGI24698J34947_10065128 | 3300002449 | Bacteria | 1778 |
| 49 | JGI24695J34938_10053494 | 3300002450 | Unclassified | 1756 |
| 50 | Ga0466712_301213 | 3300042614 | Bacteria | 1795 |
| 51 | Ga0466715_192027 | 3300042616 | Bacteria | 1453 |
| 52 | Ga0466728_010821 | 3300042620 | Bacteria | 3589 |
| 53 | Ga0466705_075535 | 3300042612 | Bacteria | 2697 |
| 54 | Ga0466706_030229 | 3300042599 | Bacteria | 2256 |
| 55 | Ga0466700_124164 | 3300042600 | Bacteria | 2424 |
| 56 | Ga0466707_118933 | 3300042601 | Bacteria | 2100 |
| 57 | Ga0466698_126380 | 3300042610 | Bacteria | 1882 |
| 58 | Ga0466694_213384 | 3300042594 | Bacteria | 2583 |
| 59 | Ga0123356_10148389 | 3300010049 | Unclassified | 2324 |
| 60 | JGI24698J34947_10060267 | 3300002449 | Bacteria | 1873 |
| 61 | JGI24695J34938_10049963 | 3300002450 | Bacteria | 1836 |
| 62 | JGI24703J35330_11685439 | 3300002501 | Bacteria | 1851 |
| 63 | Ga0466731_235790 | 3300042622 | Bacteria | 2002 |
| 64 | Ga0466734_030120 | 3300042623 | Bacteria | 1907 |
| 65 | Ga0466704_209410 | 3300042643 | Bacteria | 4985 |
| 66 | Ga0466710_125046 | 3300042613 | Bacteria | 3238 |
| 67 | Ga0466717_153933 | 3300042604 | Bacteria | 2003 |
| 68 | Ga0466717_179992 | 3300042604 | Bacteria | 1885 |
| 69 | Ga0466720_054180 | 3300042607 | Unclassified | 9343 |
| 70 | AustNasuHG_c1025035 | 3300000089 | Bacteria | 1882 |
| 71 | JGI24695J34938_10048087 | 3300002450 | Bacteria | 1880 |
| 72 | JGI24695J34938_10051090 | 3300002450 | Bacteria | 1811 |
| 73 | JGI24702J35022_10075692 | 3300002462 | Bacteria | 1818 |
| 74 | JGI24702J35022_10078906 | 3300002462 | Bacteria | 1782 |
| 75 | JGI24702J35022_10080968 | 3300002462 | Bacteria | 1759 |
| 76 | Ga0068302_10033832 | 3300005071 | Unclassified | 1772 |
| 77 | Ga0466735_105281 | 3300042624 | Bacteria | 2321 |
| 78 | Ga0466703_120199 | 3300042636 | Bacteria | 2879 |
| 79 | Ga0466717_029604 | 3300042604 | Bacteria | 1760 |
| 80 | Ga0264413_126264 | 3300024493 | Bacteria | 2548 |
| 81 | Ga0466695_239879 | 3300042595 | Bacteria | 2735 |
| 82 | Ga0123356_10264722 | 3300010049 | Bacteria | 1805 |
| 83 | Ga0123356_10264787 | 3300010049 | Bacteria | 1805 |
| 84 | Ga0123356_10275772 | 3300010049 | Bacteria | 1774 |
| 85 | Ga0123354_10233579 | 3300010882 | Bacteria | 1914 |
| 86 | AustNasuHG_c1025188 | 3300000089 | Bacteria | 1873 |
| 87 | JGI24698J34947_10032351 | 3300002449 | Bacteria | 2747 |
| 88 | JGI24695J34938_10049935 | 3300002450 | Bacteria | 1837 |
| 89 | JGI24705J35276_12210984 | 3300002504 | Bacteria | 1841 |
| 90 | Ga0072941_1240239 | 3300005201 | Bacteria | 2065 |
| 91 | Ga0466731_175356 | 3300042622 | Bacteria | 2008 |
| 92 | Ga0466709_177585 | 3300042648 | Bacteria | 2051 |
| 93 | Ga0466712_126162 | 3300042614 | Bacteria | 2404 |
| 94 | Ga0466715_125274 | 3300042616 | Bacteria | 4312 |
| 95 | Ga0466718_092021 | 3300042617 | Bacteria | 10950 |
| 96 | Ga0466717_118646 | 3300042604 | Bacteria | 2764 |
| 97 | Ga0466717_185248 | 3300042604 | Bacteria | 2689 |
| 98 | Ga0466717_196603 | 3300042604 | Bacteria | 2253 |
| 99 | Ga0466721_398797 | 3300042608 | Bacteria | 2082 |
| 100 | Ga0466698_227798 | 3300042610 | Bacteria | 2895 |
| 101 | Ga0466693_069579 | 3300042592 | Bacteria | 1859 |
| 102 | Ga0123356_10231781 | 3300010049 | Bacteria | 1911 |
| 103 | Ga0123353_10539471 | 3300010167 | Bacteria | 1686 |
| 104 | Ga0123354_10226300 | 3300010882 | Bacteria | 1970 |
| 105 | AustNasuHG_c1008443 | 3300000089 | Unclassified | 3645 |
| 106 | Ga0466704_339340 | 3300042643 | Bacteria | 4534 |
| 107 | Ga0466727_114034 | 3300042655 | Bacteria | 2970 |
| 108 | Ga0466726_251434 | 3300042619 | Bacteria | 2042 |
| 109 | Ga0466697_278918 | 3300042611 | Bacteria | 1851 |
| 110 | Ga0466705_053980 | 3300042612 | Bacteria | 1371 |
| 111 | Ga0466732_083866 | 3300042656 | Bacteria | 2184 |
| 112 | Ga0466700_006090 | 3300042600 | Bacteria | 2027 |
| 113 | Ga0466700_096698 | 3300042600 | Bacteria | 1632 |
| 114 | Ga0466700_285508 | 3300042600 | Bacteria | 1503 |
| 115 | Ga0466719_361810 | 3300042606 | Bacteria | 1989 |
| 116 | Ga0466720_070351 | 3300042607 | Bacteria | 1980 |
| 117 | Ga0466698_197673 | 3300042610 | Bacteria | 1941 |
| 118 | Ga0123355_10335975 | 3300009826 | Bacteria | 2018 |
| 119 | Ga0123356_10055972 | 3300010049 | Bacteria | 3673 |
| 120 | Ga0123353_10491452 | 3300010167 | Bacteria | 1792 |
| 121 | Ga0123353_10505263 | 3300010167 | Bacteria | 1760 |
| 122 | AustNasuHG_c1023160 | 3300000089 | Bacteria | 1987 |
| 123 | JGI24695J34938_10050950 | 3300002450 | Bacteria | 1814 |
| 124 | Ga0072940_1145863 | 3300005200 | Bacteria | 1814 |
| 125 | Ga0466731_018792 | 3300042622 | Bacteria | 1966 |
| 126 | Ga0466735_152339 | 3300042624 | Bacteria | 2024 |
| 127 | Ga0466704_248645 | 3300042643 | Bacteria | 2750 |
| 128 | Ga0466710_341946 | 3300042613 | Bacteria | 3348 |
| 129 | Ga0466711_263012 | 3300042615 | Bacteria | 32756 |
| 130 | Ga0466726_226443 | 3300042619 | Bacteria | 2052 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_285508 | Ga0466700_285508_247_1491 | 401 |
| 2 | 3300042604 | Ga0466717_029604 | Ga0466717_029604_22_1458 | 403 |
| 3 | 3300042614 | Ga0466712_180913 | Ga0466712_180913_256_1761 | 424 |
| 4 | 3300042615 | Ga0466711_034328 | Ga0466711_034328_142_1419 | 425 |
| 5 | 3300010049 | Ga0123356_10140653 | Ga0123356_101406532 | 429 |
| 6 | 3300042643 | Ga0466704_339340 | Ga0466704_339340_2579_3877 | 432 |
| 7 | 3300042612 | Ga0466705_053980 | Ga0466705_053980_49_1350 | 433 |
| 8 | 3300042643 | Ga0466704_248645 | Ga0466704_248645_499_1800 | 433 |
| 9 | 3300005071 | Ga0068302_10033832 | Ga0068302_100338321 | 435 |
| 10 | 3300002449 | JGI24698J34947_10041245 | JGI24698J34947_100412453 | 439 |
| 11 | 3300042604 | Ga0466717_118646 | Ga0466717_118646_967_2559 | 443 |
| 12 | 3300042614 | Ga0466712_015434 | Ga0466712_015434_286_1674 | 443 |
| 13 | 3300042622 | Ga0466731_434213 | Ga0466731_434213_1832_3268 | 443 |
| 14 | 3300002450 | JGI24695J34938_10053183 | JGI24695J34938_100531831 | 445 |
| 15 | 3300042597 | Ga0466699_391438 | Ga0466699_391438_1751_3289 | 448 |
| 16 | 3300042611 | Ga0466697_278918 | Ga0466697_278918_293_1771 | 450 |
| 17 | 3300042616 | Ga0466715_192027 | Ga0466715_192027_80_1435 | 451 |
| 18 | 3300002450 | JGI24695J34938_10050950 | JGI24695J34938_100509501 | 453 |
| 19 | 3300042610 | Ga0466698_126380 | Ga0466698_126380_252_1754 | 454 |
| 20 | 3300002450 | JGI24695J34938_10053494 | JGI24695J34938_100534941 | 457 |
| 21 | 3300009826 | Ga0123355_10335975 | Ga0123355_103359752 | 457 |
| 22 | 3300042622 | Ga0466731_018792 | Ga0466731_018792_190_1707 | 461 |
| 23 | 3300010049 | Ga0123356_10264722 | Ga0123356_102647221 | 462 |
| 24 | 3300042604 | Ga0466717_291405 | Ga0466717_291405_298_1854 | 464 |
| 25 | 3300042614 | Ga0466712_301213 | Ga0466712_301213_150_1691 | 464 |
| 26 | 3300042600 | Ga0466700_096698 | Ga0466700_096698_167_1609 | 465 |
| 27 | 3300010167 | Ga0123353_10539471 | Ga0123353_105394711 | 466 |
| 28 | 3300042592 | Ga0466693_059581 | Ga0466693_059581_271_1713 | 469 |
| 29 | 3300002450 | JGI24695J34938_10051090 | JGI24695J34938_100510901 | 470 |
| 30 | 3300024493 | Ga0264413_126264 | Ga0264413_1262642 | 470 |
| 31 | 3300002449 | JGI24698J34947_10032351 | JGI24698J34947_100323511 | 472 |
| 32 | 3300010049 | Ga0123356_10238639 | Ga0123356_102386391 | 472 |
| 33 | 3300042607 | Ga0466720_054180 | Ga0466720_054180_1471_3015 | 472 |
| 34 | 3300002462 | JGI24702J35022_10078906 | JGI24702J35022_100789061 | 473 |
| 35 | 3300002462 | JGI24702J35022_10080222 | JGI24702J35022_100802221 | 473 |
| 36 | 3300002501 | JGI24703J35330_11685439 | JGI24703J35330_116854391 | 474 |
| 37 | 3300010049 | Ga0123356_10221703 | Ga0123356_102217031 | 474 |
| 38 | 3300042622 | Ga0466731_192735 | Ga0466731_192735_738_2255 | 475 |
| 39 | 3300010167 | Ga0123353_10505263 | Ga0123353_105052632 | 476 |
| 40 | 3300042604 | Ga0466717_193071 | Ga0466717_193071_33_1517 | 476 |
| 41 | 3300042601 | Ga0466707_118933 | Ga0466707_118933_439_1875 | 478 |
| 42 | 3300010049 | Ga0123356_10275772 | Ga0123356_102757721 | 480 |
| 43 | 3300002462 | JGI24702J35022_10075692 | JGI24702J35022_100756921 | 481 |
| 44 | 3300042617 | Ga0466718_092021 | Ga0466718_092021_7930_9471 | 481 |
| 45 | 3300042622 | Ga0466731_175356 | Ga0466731_175356_246_1781 | 481 |
| 46 | 3300005200 | Ga0072940_1145863 | Ga0072940_11458631 | 482 |
| 47 | 3300010167 | Ga0123353_10446223 | Ga0123353_104462232 | 483 |
| 48 | 3300042614 | Ga0466712_131691 | Ga0466712_131691_150_1694 | 483 |
| 49 | 3300042610 | Ga0466698_197673 | Ga0466698_197673_373_1917 | 484 |
| 50 | 3300042608 | Ga0466721_398797 | Ga0466721_398797_257_1846 | 485 |
| 51 | 3300010049 | Ga0123356_10202507 | Ga0123356_102025072 | 486 |
| 52 | 3300010049 | Ga0123356_10222193 | Ga0123356_102221932 | 486 |
| 53 | 3300042599 | Ga0466706_030229 | Ga0466706_030229_112_1656 | 486 |
| 54 | 3300042615 | Ga0466711_263012 | Ga0466711_263012_132_1673 | 486 |
| 55 | 3300042604 | Ga0466717_185248 | Ga0466717_185248_650_2143 | 487 |
| 56 | 3300042611 | Ga0466697_183335 | Ga0466697_183335_199_1755 | 487 |
| 57 | 3300042614 | Ga0466712_084420 | Ga0466712_084420_253_1797 | 487 |
| 58 | 3300042614 | Ga0466712_121080 | Ga0466712_121080_156_1661 | 488 |
| 59 | 3300002450 | JGI24695J34938_10049963 | JGI24695J34938_100499631 | 489 |
| 60 | 3300042617 | Ga0466718_124993 | Ga0466718_124993_318_1817 | 489 |
| 61 | 3300002450 | JGI24695J34938_10048087 | JGI24695J34938_100480871 | 490 |
| 62 | 3300042600 | Ga0466700_161780 | Ga0466700_161780_173_1684 | 491 |
| 63 | 3300042614 | Ga0466712_126162 | Ga0466712_126162_396_1940 | 492 |
| 64 | 3300042607 | Ga0466720_094845 | Ga0466720_094845_131_1675 | 493 |
| 65 | 3300010167 | Ga0123353_10408154 | Ga0123353_104081542 | 495 |
| 66 | 3300042607 | Ga0466720_070351 | Ga0466720_070351_211_1755 | 495 |
| 67 | 3300042656 | Ga0466732_083866 | Ga0466732_083866_154_1695 | 496 |
| 68 | 3300002449 | JGI24698J34947_10065128 | JGI24698J34947_100651281 | 497 |
| 69 | 3300042614 | Ga0466712_049347 | Ga0466712_049347_326_1870 | 497 |
| 70 | 3300010049 | Ga0123356_10184126 | Ga0123356_101841261 | 498 |
| 71 | 3300010882 | Ga0123354_10226300 | Ga0123354_102263001 | 498 |
| 72 | 3300042620 | Ga0466728_010821 | Ga0466728_010821_381_1922 | 498 |
| 73 | 3300042595 | Ga0466695_010029 | Ga0466695_010029_204_1820 | 499 |
| 74 | 3300010049 | Ga0123356_10055972 | Ga0123356_100559721 | 500 |
| 75 | 3300010049 | Ga0123356_10264787 | Ga0123356_102647871 | 500 |
| 76 | 3300042594 | Ga0466694_213384 | Ga0466694_213384_197_1699 | 500 |
| 77 | 3300002504 | JGI24705J35276_12210984 | JGI24705J35276_122109841 | 501 |
| 78 | 3300000089 | AustNasuHG_c1027569 | AustNasuHG_10275691 | 502 |
| 79 | 3300002462 | JGI24702J35022_10080968 | JGI24702J35022_100809681 | 502 |
| 80 | 3300010167 | Ga0123353_10491452 | Ga0123353_104914521 | 502 |
| 81 | 3300042623 | Ga0466734_030120 | Ga0466734_030120_175_1683 | 502 |
| 82 | 3300042659 | Ga0466733_031813 | Ga0466733_031813_2982_4490 | 502 |
| 83 | 3300042659 | Ga0466733_150001 | Ga0466733_150001_48_1601 | 502 |
| 84 | 3300042600 | Ga0466700_124164 | Ga0466700_124164_132_1643 | 503 |
| 85 | 3300042600 | Ga0466700_312047 | Ga0466700_312047_174_1685 | 503 |
| 86 | 3300042604 | Ga0466717_179992 | Ga0466717_179992_47_1639 | 503 |
| 87 | 3300010049 | Ga0123356_10231781 | Ga0123356_102317811 | 504 |
| 88 | 3300010167 | Ga0123353_10526899 | Ga0123353_105268991 | 504 |
| 89 | 3300005201 | Ga0072941_1240239 | Ga0072941_12402391 | 505 |
| 90 | 3300000089 | AustNasuHG_c1025188 | AustNasuHG_10251882 | 506 |
| 91 | 3300042610 | Ga0466698_227798 | Ga0466698_227798_1119_2663 | 506 |
| 92 | 3300010049 | Ga0123356_10226118 | Ga0123356_102261181 | 508 |
| 93 | iso_pr_bacteria | 8048923410 | 8048925028 | 509 |
| 94 | iso_pr_bacteria | 8048923410 | 8048925095 | 509 |
| 95 | iso_pr_bacteria | 8048923410 | 8048927717 | 509 |
| 96 | 3300009784 | Ga0123357_10179920 | Ga0123357_101799202 | 510 |
| 97 | 3300042606 | Ga0466719_242141 | Ga0466719_242141_1857_3392 | 511 |
| 98 | 3300042613 | Ga0466710_341946 | Ga0466710_341946_988_2544 | 511 |
| 99 | 3300042601 | Ga0466707_198908 | Ga0466707_198908_354_1892 | 512 |
| 100 | 3300042605 | Ga0466716_145036 | Ga0466716_145036_357_1895 | 512 |
| 101 | 3300042616 | Ga0466715_125274 | Ga0466715_125274_2712_4250 | 512 |
| 102 | 3300042624 | Ga0466735_105281 | Ga0466735_105281_413_1951 | 512 |
| 103 | iso_pr_bacteria | 650716099 | 650878986 | 512 |
| 104 | iso_pr_bacteria | 650716099 | 650880670 | 512 |
| 105 | 3300042595 | Ga0466695_239879 | Ga0466695_239879_386_1927 | 513 |
| 106 | 3300042606 | Ga0466719_361810 | Ga0466719_361810_278_1819 | 513 |
| 107 | 3300042612 | Ga0466705_075535 | Ga0466705_075535_207_1748 | 513 |
| 108 | 3300042636 | Ga0466703_120199 | Ga0466703_120199_391_1932 | 513 |
| 109 | 3300042643 | Ga0466704_209410 | Ga0466704_209410_2911_4452 | 513 |
| 110 | 3300042648 | Ga0466709_177585 | Ga0466709_177585_431_1972 | 513 |
| 111 | 3300002449 | JGI24698J34947_10060267 | JGI24698J34947_100602671 | 514 |
| 112 | 3300042624 | Ga0466735_152339 | Ga0466735_152339_19_1563 | 514 |
| 113 | 3300042600 | Ga0466700_006090 | Ga0466700_006090_242_1789 | 515 |
| 114 | 3300042619 | Ga0466726_226443 | Ga0466726_226443_230_1777 | 515 |
| 115 | 3300042623 | Ga0466734_139687 | Ga0466734_139687_267_1814 | 515 |
| 116 | 3300042599 | Ga0466706_164563 | Ga0466706_164563_167_1717 | 516 |
| 117 | 3300042619 | Ga0466726_251434 | Ga0466726_251434_293_1843 | 516 |
| 118 | 3300042655 | Ga0466727_114034 | Ga0466727_114034_1180_2730 | 516 |
| 119 | 3300000089 | AustNasuHG_c1008443 | AustNasuHG_10084432 | 517 |
| 120 | 3300000089 | AustNasuHG_c1023160 | AustNasuHG_10231602 | 517 |
| 121 | 3300000089 | AustNasuHG_c1025035 | AustNasuHG_10250352 | 517 |
| 122 | 3300042622 | Ga0466731_235790 | Ga0466731_235790_309_1910 | 517 |
| 123 | 3300009784 | Ga0123357_10275042 | Ga0123357_102750421 | 518 |
| 124 | 3300042595 | Ga0466695_033648 | Ga0466695_033648_852_2408 | 518 |
| 125 | 3300042604 | Ga0466717_153933 | Ga0466717_153933_181_1737 | 518 |
| 126 | 3300042604 | Ga0466717_196603 | Ga0466717_196603_380_1936 | 518 |
| 127 | 3300042613 | Ga0466710_125046 | Ga0466710_125046_101_1657 | 518 |
| 128 | 3300002462 | JGI24702J35022_10019828 | JGI24702J35022_100198281 | 519 |
| 129 | 3300002462 | JGI24702J35022_10072550 | JGI24702J35022_100725502 | 519 |
| 130 | 3300010049 | Ga0123356_10148389 | Ga0123356_101483891 | 519 |
| 131 | 3300010049 | Ga0123356_10176511 | Ga0123356_101765111 | 519 |
| 132 | 3300002450 | JGI24695J34938_10049935 | JGI24695J34938_100499351 | 520 |
| 133 | 3300042608 | Ga0466721_104830 | Ga0466721_104830_68_1630 | 520 |
| 134 | 3300010882 | Ga0123354_10233579 | Ga0123354_102335791 | 528 |
| 135 | 3300042592 | Ga0466693_069579 | Ga0466693_069579_53_1663 | 536 |
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.