Protein Family IF04712
Metagenome
Isolate
233
Members
58
Samples
227
Scaffolds
249.12
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_166211|Ga0466692_166211_235_1071
- Length
- 278 aa
- Sequence
- MKKIKDFITGILVIVLLGGGVFWVYRHEKNKTHEALAKRIAELSPRGGPPETIEGLKAAIALYEAQIELNVKEGAQTGSYWKILAVRLADKGMHQDALSALERALYYNAEDPTLFYLTGVSAATAAKAALGFSNNKESGKEHYFALAETAYLRSLEIDSEYPKPMYGLGVLYVFELDRPAEAVPYLEHYLKQLSGDISAMFVLARAYYMTGNNEGAVELYDRIISRTKDQKIKAEAQNNRDYIRGQMYGRTRTFGFCNFPPSRAFFPGQGLPLQNLRL
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.4%
Kalotermitidae
25.0%
Unclassified
16.1%
Termopsidae
7.1%
Rhinotermitidae
5.4%
Taxonomy
Archaea
2
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 54 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 55 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_107554 | 3300042612 | Bacteria | 51815 |
| 2 | Ga0466732_163045 | 3300042656 | Bacteria | 1586 |
| 3 | Ga0466701_056520 | 3300042598 | Bacteria | 3973 |
| 4 | Ga0466700_283837 | 3300042600 | Bacteria | 1780 |
| 5 | Ga0466707_422163 | 3300042601 | Bacteria | 1816 |
| 6 | Ga0466720_028054 | 3300042607 | Bacteria | 2840 |
| 7 | Ga0466720_102848 | 3300042607 | Bacteria | 7412 |
| 8 | Ga0466720_152287 | 3300042607 | Bacteria | 15618 |
| 9 | Ga0466722_128050 | 3300042609 | Bacteria | 3098 |
| 10 | Ga0123356_10005586 | 3300010049 | Bacteria | 12789 |
| 11 | Ga0123353_10092749 | 3300010167 | Bacteria | 4865 |
| 12 | Ga0123353_10194218 | 3300010167 | Bacteria | 3201 |
| 13 | Ga0264413_101605 | 3300024493 | Bacteria | 8622 |
| 14 | Ga0466690_215433 | 3300042590 | Bacteria | 3323 |
| 15 | Ga0466692_089878 | 3300042591 | Bacteria | 11422 |
| 16 | Ga0466699_107999 | 3300042597 | Bacteria | 7350 |
| 17 | AustNasuHG_c1001550 | 3300000089 | Bacteria | 8278 |
| 18 | JGI24702J35022_10209524 | 3300002462 | Bacteria | 1119 |
| 19 | Ga0068305_10013036 | 3300005083 | Unclassified | 3427 |
| 20 | Ga0072940_1098404 | 3300005200 | Bacteria | 1625 |
| 21 | Ga0072941_1123080 | 3300005201 | Bacteria | 1446 |
| 22 | Ga0466702_322594 | 3300042635 | Bacteria | 6995 |
| 23 | Ga0466704_335796 | 3300042643 | Bacteria | 67702 |
| 24 | Ga0466712_014889 | 3300042614 | Bacteria | 58641 |
| 25 | Ga0466711_236469 | 3300042615 | Bacteria | 97130 |
| 26 | Ga0466718_023058 | 3300042617 | Bacteria | 1902 |
| 27 | Ga0466723_316820 | 3300042618 | Bacteria | 7877 |
| 28 | Ga0466728_415740 | 3300042620 | Bacteria | 20737 |
| 29 | Ga0466713_137640 | 3300042602 | Bacteria | 17260 |
| 30 | Ga0466717_137933 | 3300042604 | Bacteria | 1890 |
| 31 | Ga0466720_110846 | 3300042607 | Bacteria | 1530 |
| 32 | Ga0466722_084424 | 3300042609 | Bacteria | 13101 |
| 33 | Ga0466722_148333 | 3300042609 | Bacteria | 19150 |
| 34 | Ga0466698_053901 | 3300042610 | Bacteria | 4137 |
| 35 | Ga0123353_10865274 | 3300010167 | Bacteria | 1236 |
| 36 | Ga0264413_100066 | 3300024493 | Bacteria | 7302 |
| 37 | Ga0466694_093304 | 3300042594 | Bacteria | 7295 |
| 38 | Ga0466694_365203 | 3300042594 | Bacteria | 39783 |
| 39 | Ga0466694_407693 | 3300042594 | Bacteria | 1431 |
| 40 | Ga0072940_1001186 | 3300005200 | Bacteria | 16310 |
| 41 | Ga0072940_1001773 | 3300005200 | Bacteria | 7243 |
| 42 | Ga0072941_1182187 | 3300005201 | Bacteria | 2361 |
| 43 | Ga0466703_015135 | 3300042636 | Bacteria | 49157 |
| 44 | Ga0466709_407136 | 3300042648 | Bacteria | 6478 |
| 45 | Ga0466727_110732 | 3300042655 | Bacteria | 2549 |
| 46 | Ga0466727_191331 | 3300042655 | Bacteria | 3877 |
| 47 | Ga0466712_102256 | 3300042614 | Bacteria | 5786 |
| 48 | Ga0466715_424591 | 3300042616 | Bacteria | 27710 |
| 49 | Ga0466718_005755 | 3300042617 | Bacteria | 1811 |
| 50 | Ga0466718_015794 | 3300042617 | Bacteria | 1436 |
| 51 | Ga0466718_028656 | 3300042617 | Bacteria | 3677 |
| 52 | Ga0466707_252078 | 3300042601 | Bacteria | 3103 |
| 53 | Ga0466720_008311 | 3300042607 | Bacteria | 24251 |
| 54 | Ga0466720_088525 | 3300042607 | Bacteria | 28475 |
| 55 | Ga0466720_166212 | 3300042607 | Bacteria | 5299 |
| 56 | Ga0264413_100619 | 3300024493 | Bacteria | 17189 |
| 57 | Ga0264413_113598 | 3300024493 | Bacteria | 2032 |
| 58 | Ga0466692_204049 | 3300042591 | Bacteria | 14250 |
| 59 | Ga0466699_013731 | 3300042597 | Bacteria | 18459 |
| 60 | Ga0466699_048302 | 3300042597 | Bacteria | 27605 |
| 61 | Ga0466699_079100 | 3300042597 | Bacteria | 3295 |
| 62 | Ga0466699_081838 | 3300042597 | Bacteria | 1509 |
| 63 | 2230954182 | 2228664003 | Bacteria | 42398 |
| 64 | AustNasuHG_c1000440 | 3300000089 | Bacteria | 14540 |
| 65 | Ga0072940_1009968 | 3300005200 | Bacteria | 4703 |
| 66 | Ga0466712_244442 | 3300042614 | Bacteria | 2374 |
| 67 | Ga0466718_024162 | 3300042617 | Bacteria | 8934 |
| 68 | Ga0466718_105539 | 3300042617 | Bacteria | 10642 |
| 69 | Ga0466718_109163 | 3300042617 | Bacteria | 2089 |
| 70 | Ga0466718_144126 | 3300042617 | Bacteria | 1460 |
| 71 | Ga0466723_195456 | 3300042618 | Bacteria | 36467 |
| 72 | Ga0466726_361117 | 3300042619 | Bacteria | 2855 |
| 73 | Ga0466705_053793 | 3300042612 | Bacteria | 32940 |
| 74 | Ga0466705_203092 | 3300042612 | Bacteria | 17319 |
| 75 | Ga0466732_119135 | 3300042656 | Bacteria | 1579 |
| 76 | Ga0466732_212764 | 3300042656 | Bacteria | 14753 |
| 77 | Ga0466733_093779 | 3300042659 | Bacteria | 4120 |
| 78 | Ga0466733_174240 | 3300042659 | Bacteria | 1859 |
| 79 | Ga0466713_075554 | 3300042602 | Bacteria | 3228 |
| 80 | Ga0466720_004549 | 3300042607 | Bacteria | 33303 |
| 81 | Ga0466720_029739 | 3300042607 | Bacteria | 15512 |
| 82 | Ga0466720_075169 | 3300042607 | Bacteria | 7952 |
| 83 | Ga0466720_118501 | 3300042607 | Bacteria | 2843 |
| 84 | Ga0466722_056980 | 3300042609 | Bacteria | 22686 |
| 85 | Ga0466698_500736 | 3300042610 | Bacteria | 1549 |
| 86 | Ga0123356_10141354 | 3300010049 | Bacteria | 2375 |
| 87 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 88 | Ga0415639_263770 | 3300038395 | Bacteria | 1488 |
| 89 | Ga0456237_0003213 | 3300041968 | Unclassified | 2652 |
| 90 | Ga0466692_087029 | 3300042591 | Bacteria | 12400 |
| 91 | Ga0466694_139806 | 3300042594 | Bacteria | 3615 |
| 92 | Ga0466696_065898 | 3300042596 | Bacteria | 20669 |
| 93 | JGI24698J34947_10000938 | 3300002449 | Bacteria | 14829 |
| 94 | JGI24698J34947_10032849 | 3300002449 | Bacteria | 2723 |
| 95 | Ga0072940_1001005 | 3300005200 | Bacteria | 16696 |
| 96 | Ga0072941_1123081 | 3300005201 | Bacteria | 2108 |
| 97 | Ga0466731_170375 | 3300042622 | Bacteria | 1169 |
| 98 | Ga0466735_082208 | 3300042624 | Bacteria | 4698 |
| 99 | Ga0466703_041012 | 3300042636 | Bacteria | 25158 |
| 100 | Ga0466708_010753 | 3300042652 | Bacteria | 16107 |
| 101 | Ga0466712_036172 | 3300042614 | Bacteria | 2212 |
| 102 | Ga0466718_023902 | 3300042617 | Bacteria | 2006 |
| 103 | Ga0466718_049472 | 3300042617 | Bacteria | 1572 |
| 104 | Ga0466718_128417 | 3300042617 | Bacteria | 4376 |
| 105 | Ga0466718_135609 | 3300042617 | Bacteria | 4568 |
| 106 | Ga0466723_024084 | 3300042618 | Bacteria | 42350 |
| 107 | Ga0466726_223923 | 3300042619 | Bacteria | 1771 |
| 108 | Ga0466727_351309 | 3300042655 | Bacteria | 3701 |
| 109 | Ga0466732_089275 | 3300042656 | Bacteria | 18300 |
| 110 | Ga0466732_188243 | 3300042656 | Bacteria | 9939 |
| 111 | Ga0466732_255773 | 3300042656 | Bacteria | 2012 |
| 112 | Ga0466701_092838 | 3300042598 | Bacteria | 1077 |
| 113 | Ga0466707_134783 | 3300042601 | Bacteria | 1516 |
| 114 | Ga0466720_029334 | 3300042607 | Bacteria | 12784 |
| 115 | Ga0466720_047975 | 3300042607 | Bacteria | 12556 |
| 116 | Ga0466720_054989 | 3300042607 | Bacteria | 24698 |
| 117 | Ga0466720_155945 | 3300042607 | Bacteria | 5038 |
| 118 | Ga0123356_10108482 | 3300010049 | Bacteria | 2677 |
| 119 | Ga0264413_101071 | 3300024493 | Bacteria | 9430 |
| 120 | Ga0264413_118279 | 3300024493 | Bacteria | 2671 |
| 121 | Ga0466690_108851 | 3300042590 | Bacteria | 21034 |
| 122 | Ga0466692_009608 | 3300042591 | Bacteria | 27328 |
| 123 | Ga0466693_121705 | 3300042592 | Bacteria | 24410 |
| 124 | Ga0466694_151108 | 3300042594 | Bacteria | 1089 |
| 125 | Ga0466695_006127 | 3300042595 | Bacteria | 69665 |
| 126 | Ga0466699_400500 | 3300042597 | Archaea | 2890 |
| 127 | AustNasuHG_c1001402 | 3300000089 | Bacteria | 8627 |
| 128 | JGI24698J34947_10001807 | 3300002449 | Bacteria | 11415 |
| 129 | JGI24695J34938_10015897 | 3300002450 | Bacteria | 3847 |
| 130 | Ga0068302_10521904 | 3300005071 | Bacteria | 1344 |
| 131 | Ga0072941_1020243 | 3300005201 | Bacteria | 1902 |
| 132 | Ga0072941_1294291 | 3300005201 | Bacteria | 1945 |
| 133 | Ga0074263_106696 | 3300005485 | Bacteria | 3348 |
| 134 | Ga0466731_316957 | 3300042622 | Bacteria | 8427 |
| 135 | Ga0466703_220845 | 3300042636 | Bacteria | 51302 |
| 136 | Ga0466712_064389 | 3300042614 | Bacteria | 6084 |
| 137 | Ga0466711_431565 | 3300042615 | Bacteria | 1602 |
| 138 | Ga0466718_124748 | 3300042617 | Bacteria | 10796 |
| 139 | Ga0466718_130615 | 3300042617 | Bacteria | 5083 |
| 140 | Ga0466723_081328 | 3300042618 | Bacteria | 12661 |
| 141 | Ga0466728_073061 | 3300042620 | Bacteria | 4283 |
| 142 | Ga0466733_020925 | 3300042659 | Bacteria | 34524 |
| 143 | Ga0466733_043624 | 3300042659 | Bacteria | 28843 |
| 144 | Ga0466733_081151 | 3300042659 | Bacteria | 3416 |
| 145 | Ga0466733_110809 | 3300042659 | Bacteria | 1561 |
| 146 | Ga0466733_132939 | 3300042659 | Bacteria | 2947 |
| 147 | Ga0466716_201114 | 3300042605 | Bacteria | 39030 |
| 148 | Ga0466716_524345 | 3300042605 | Bacteria | 5851 |
| 149 | Ga0466698_075084 | 3300042610 | Bacteria | 1688 |
| 150 | Ga0264413_101133 | 3300024493 | Bacteria | 21360 |
| 151 | Ga0264413_102445 | 3300024493 | Bacteria | 3385 |
| 152 | Ga0264413_103098 | 3300024493 | Bacteria | 12802 |
| 153 | Ga0264413_106691 | 3300024493 | Bacteria | 5406 |
| 154 | Ga0264413_108778 | 3300024493 | Bacteria | 9557 |
| 155 | Ga0456237_0004911 | 3300041968 | Unclassified | 2138 |
| 156 | Ga0466691_084024 | 3300042593 | Bacteria | 72854 |
| 157 | Ga0466691_177940 | 3300042593 | Bacteria | 20777 |
| 158 | Ga0466694_026162 | 3300042594 | Bacteria | 6229 |
| 159 | Ga0466699_266316 | 3300042597 | Bacteria | 21193 |
| 160 | AustNasuHG_c1004190 | 3300000089 | Bacteria | 5180 |
| 161 | JGI24698J34947_10003516 | 3300002449 | Unclassified | 8509 |
| 162 | JGI24698J34947_10024993 | 3300002449 | Unclassified | 3183 |
| 163 | JGI24698J34947_10029118 | 3300002449 | Bacteria | 2920 |
| 164 | Ga0072940_1021456 | 3300005200 | Bacteria | 20392 |
| 165 | Ga0072941_1002921 | 3300005201 | Bacteria | 8241 |
| 166 | Ga0466704_082141 | 3300042643 | Bacteria | 21700 |
| 167 | Ga0466709_327794 | 3300042648 | Bacteria | 2545 |
| 168 | Ga0466712_013606 | 3300042614 | Bacteria | 25228 |
| 169 | Ga0466723_047931 | 3300042618 | Bacteria | 55036 |
| 170 | Ga0466726_217109 | 3300042619 | Bacteria | 4041 |
| 171 | Ga0466733_152878 | 3300042659 | Bacteria | 3227 |
| 172 | Ga0466720_014617 | 3300042607 | Bacteria | 13721 |
| 173 | Ga0466720_032036 | 3300042607 | Bacteria | 49795 |
| 174 | Ga0123356_10095841 | 3300010049 | Bacteria | 2836 |
| 175 | Ga0264413_133356 | 3300024493 | Bacteria | 4730 |
| 176 | Ga0466692_143975 | 3300042591 | Bacteria | 9188 |
| 177 | Ga0466691_034660 | 3300042593 | Bacteria | 57357 |
| 178 | Ga0466694_139190 | 3300042594 | Bacteria | 4301 |
| 179 | Ga0466696_075410 | 3300042596 | Bacteria | 18499 |
| 180 | AustNasuHG_c1023492 | 3300000089 | Bacteria | 1967 |
| 181 | JGI24698J34947_10012554 | 3300002449 | Bacteria | 4642 |
| 182 | JGI24698J34947_10051920 | 3300002449 | Bacteria | 2059 |
| 183 | JGI24698J34947_10068782 | 3300002449 | Unclassified | 1711 |
| 184 | Ga0072941_1027439 | 3300005201 | Bacteria | 2966 |
| 185 | Ga0466702_188190 | 3300042635 | Bacteria | 1746 |
| 186 | Ga0466703_049531 | 3300042636 | Bacteria | 42822 |
| 187 | Ga0466704_293723 | 3300042643 | Bacteria | 10371 |
| 188 | Ga0466704_299159 | 3300042643 | Bacteria | 58999 |
| 189 | Ga0466708_086152 | 3300042652 | Bacteria | 9560 |
| 190 | Ga0466708_137023 | 3300042652 | Bacteria | 4037 |
| 191 | Ga0466727_164686 | 3300042655 | Bacteria | 1971 |
| 192 | Ga0466712_012063 | 3300042614 | Bacteria | 7656 |
| 193 | Ga0466712_014594 | 3300042614 | Bacteria | 7929 |
| 194 | Ga0466718_082040 | 3300042617 | Bacteria | 5386 |
| 195 | Ga0466732_166679 | 3300042656 | Bacteria | 1139 |
| 196 | Ga0466719_322075 | 3300042606 | Bacteria | 7373 |
| 197 | Ga0466720_018335 | 3300042607 | Bacteria | 10868 |
| 198 | Ga0466722_089642 | 3300042609 | Bacteria | 44895 |
| 199 | Ga0123354_10059112 | 3300010882 | Bacteria | 5689 |
| 200 | Ga0264413_100618 | 3300024493 | Bacteria | 16207 |
| 201 | Ga0264413_101131 | 3300024493 | Bacteria | 3221 |
| 202 | Ga0466692_166211 | 3300042591 | Bacteria | 2609 |
| 203 | Ga0466691_112019 | 3300042593 | Bacteria | 1009 |
| 204 | Ga0466694_035875 | 3300042594 | Bacteria | 2667 |
| 205 | Ga0466694_131062 | 3300042594 | Bacteria | 33615 |
| 206 | Ga0466694_147366 | 3300042594 | Bacteria | 19033 |
| 207 | Ga0466694_384120 | 3300042594 | Bacteria | 1989 |
| 208 | Ga0466696_188486 | 3300042596 | Bacteria | 8606 |
| 209 | Ga0466699_165436 | 3300042597 | Bacteria | 24100 |
| 210 | AustNasuHG_c1000040 | 3300000089 | Bacteria | 32335 |
| 211 | JGI24698J34947_10006361 | 3300002449 | Archaea | 6483 |
| 212 | JGI24698J34947_10011142 | 3300002449 | Bacteria | 4935 |
| 213 | JGI24698J34947_10015418 | 3300002449 | Bacteria | 4160 |
| 214 | JGI24698J34947_10020598 | 3300002449 | Bacteria | 3551 |
| 215 | JGI24698J34947_10064391 | 3300002449 | Bacteria | 1792 |
| 216 | JGI24698J34947_10102328 | 3300002449 | Bacteria | 1285 |
| 217 | Ga0072940_1562081 | 3300005200 | Bacteria | 1126 |
| 218 | Ga0072941_1036958 | 3300005201 | Bacteria | 7382 |
| 219 | Ga0466709_256424 | 3300042648 | Bacteria | 3803 |
| 220 | Ga0466708_202662 | 3300042652 | Bacteria | 29963 |
| 221 | Ga0466712_117468 | 3300042614 | Bacteria | 53603 |
| 222 | Ga0466712_246201 | 3300042614 | Bacteria | 2563 |
| 223 | Ga0466715_516662 | 3300042616 | Bacteria | 30690 |
| 224 | Ga0466718_000332 | 3300042617 | Bacteria | 25424 |
| 225 | Ga0466718_006469 | 3300042617 | Bacteria | 9143 |
| 226 | Ga0466718_022195 | 3300042617 | Bacteria | 21708 |
| 227 | Ga0466718_030996 | 3300042617 | Bacteria | 12488 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.