Protein Family IF04702
Metagenome
Isolate
175
Members
66
Samples
156
Scaffolds
419.37
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_153769|Ga0466692_153769_3907_5421
- Length
- 504 aa
- Sequence
- MSPLSAKKQRPFNKLAPKPDRVLREPRDFSGESPGLYNSNITKKERNLNRAGRVELHDSCSSFTIRPNERHRPVMAQYSLIKTLVELRGNPRACVFTEPLWGLSMNLCIPYASVYMLALGLKDADVGFIATVYMLTQVVSGLLGGVITDKLGRRKTTAIFDFISWSIPCLIWMRAQGFWFFFVAALFNGVMKVTTNSWDCLLVEDAEKSQVTRIYSLIIVCGQLSALFAPISSILVSRLTLVPAIRILYVNAFIVMTIKLLLLYFFSRETRTGVTRIQQTKGVSFFRLLAGYGGIFRIIGKSKGTIFSLVIAALVGAVGMVNNTFWQIIASKKILVPDPLLPLFPMFRSLLAIAFLFLVTPRLLKVNLRSPLLYGFAACIIGQAVLVLTPAEGVTRYLILCVSLVFDGFGLGTLMMMAESLVALHVDRAERARVMAIQHMIIMFATTPFGWIGGILSGMNRGFPFVLNIVLLAAGLGVTLFYYHRNPGEAMAGHENESPVSEQT
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.4%
Termitidae
32.8%
Kalotermitidae
21.9%
Rhinotermitidae
6.2%
Termopsidae
4.7%
Taxonomy
Archaea
0
Bacteria
162
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 13 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 21 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 28 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 29 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 37 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 38 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 48 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 49 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 50 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 56 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 57 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 58 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 59 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 60 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 61 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 64 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 65 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_205641 | 3300042621 | Bacteria | 1500 |
| 2 | Ga0466708_159329 | 3300042652 | Bacteria | 2278 |
| 3 | Ga0123355_10000545 | 3300009826 | Bacteria | 50565 |
| 4 | Ga0123356_10000361 | 3300010049 | Bacteria | 51710 |
| 5 | Ga0466713_056644 | 3300042602 | Bacteria | 143033 |
| 6 | Ga0466716_085974 | 3300042605 | Bacteria | 7895 |
| 7 | Ga0466722_054210 | 3300042609 | Bacteria | 4501 |
| 8 | Ga0264413_110804 | 3300024493 | Bacteria | 2561 |
| 9 | Ga0466690_306767 | 3300042590 | Bacteria | 6939 |
| 10 | Ga0466691_000817 | 3300042593 | Bacteria | 11709 |
| 11 | Ga0466691_076251 | 3300042593 | Bacteria | 5037 |
| 12 | Ga0466691_104086 | 3300042593 | Bacteria | 10835 |
| 13 | Ga0466696_348440 | 3300042596 | Bacteria | 5431 |
| 14 | AustNasuHG_c1002300 | 3300000089 | Bacteria | 6895 |
| 15 | Ga0466712_109596 | 3300042614 | Bacteria | 15349 |
| 16 | Ga0466711_435382 | 3300042615 | Bacteria | 2741 |
| 17 | Ga0466715_289164 | 3300042616 | Bacteria | 65907 |
| 18 | Ga0466723_080142 | 3300042618 | Bacteria | 6159 |
| 19 | Ga0466723_093211 | 3300042618 | Bacteria | 3179 |
| 20 | Ga0466705_168307 | 3300042612 | Bacteria | 17645 |
| 21 | Ga0466731_112040 | 3300042622 | Bacteria | 4113 |
| 22 | Ga0466731_337384 | 3300042622 | Bacteria | 6120 |
| 23 | Ga0466708_330747 | 3300042652 | Bacteria | 6589 |
| 24 | Ga0466727_011086 | 3300042655 | Bacteria | 4563 |
| 25 | Ga0123354_10023196 | 3300010882 | Bacteria | 9788 |
| 26 | Ga0466707_008801 | 3300042601 | Bacteria | 4974 |
| 27 | Ga0466719_036914 | 3300042606 | Bacteria | 9855 |
| 28 | Ga0466720_009545 | 3300042607 | Unclassified | 2295 |
| 29 | Ga0466720_098710 | 3300042607 | Bacteria | 26481 |
| 30 | Ga0264413_101220 | 3300024493 | Bacteria | 47245 |
| 31 | Ga0466692_153769 | 3300042591 | Bacteria | 29297 |
| 32 | Ga0466694_379709 | 3300042594 | Bacteria | 72022 |
| 33 | JGI24698J34947_10001002 | 3300002449 | Bacteria | 14498 |
| 34 | JGI24698J34947_10006174 | 3300002449 | Unclassified | 6581 |
| 35 | JGI24695J34938_10000172 | 3300002450 | Bacteria | 60289 |
| 36 | JGI24695J34938_10005837 | 3300002450 | Bacteria | 7572 |
| 37 | JGI24695J34938_10009573 | 3300002450 | Bacteria | 5378 |
| 38 | JGI24695J34938_10027660 | 3300002450 | Bacteria | 2677 |
| 39 | Ga0466711_048039 | 3300042615 | Bacteria | 4434 |
| 40 | Ga0466715_136346 | 3300042616 | Bacteria | 9194 |
| 41 | Ga0466723_182417 | 3300042618 | Bacteria | 25448 |
| 42 | Ga0466726_057668 | 3300042619 | Unclassified | 1419 |
| 43 | Ga0466728_100043 | 3300042620 | Bacteria | 11491 |
| 44 | Ga0466731_305804 | 3300042622 | Bacteria | 5372 |
| 45 | Ga0466708_056844 | 3300042652 | Bacteria | 13240 |
| 46 | Ga0466725_411436 | 3300042654 | Bacteria | 3582 |
| 47 | Ga0123357_10021504 | 3300009784 | Unclassified | 8639 |
| 48 | Ga0466716_072807 | 3300042605 | Bacteria | 11205 |
| 49 | Ga0466719_055835 | 3300042606 | Unclassified | 4764 |
| 50 | Ga0466722_078774 | 3300042609 | Bacteria | 13469 |
| 51 | Ga0466690_045368 | 3300042590 | Bacteria | 6022 |
| 52 | Ga0466690_339415 | 3300042590 | Bacteria | 9655 |
| 53 | Ga0466692_088613 | 3300042591 | Unclassified | 1800 |
| 54 | Ga0466692_097328 | 3300042591 | Bacteria | 28105 |
| 55 | JGI24699J35502_11093422 | 3300002509 | Bacteria | 2183 |
| 56 | JGI24699J35502_11134221 | 3300002509 | Bacteria | 67001 |
| 57 | Ga0123357_10000916 | 3300009784 | Bacteria | 29940 |
| 58 | Ga0466715_092636 | 3300042616 | Bacteria | 18886 |
| 59 | Ga0466715_210163 | 3300042616 | Bacteria | 48320 |
| 60 | Ga0466723_230343 | 3300042618 | Bacteria | 8895 |
| 61 | Ga0466723_293452 | 3300042618 | Bacteria | 17268 |
| 62 | Ga0466703_048387 | 3300042636 | Bacteria | 27078 |
| 63 | Ga0466703_232815 | 3300042636 | Unclassified | 4739 |
| 64 | Ga0466704_053949 | 3300042643 | Bacteria | 11015 |
| 65 | Ga0466704_334066 | 3300042643 | Bacteria | 5467 |
| 66 | Ga0466704_414935 | 3300042643 | Bacteria | 5677 |
| 67 | Ga0466709_144867 | 3300042648 | Bacteria | 8129 |
| 68 | Ga0123356_10000289 | 3300010049 | Bacteria | 57741 |
| 69 | Ga0123356_10000624 | 3300010049 | Bacteria | 39100 |
| 70 | Ga0123356_10005725 | 3300010049 | Bacteria | 12629 |
| 71 | Ga0123353_10011967 | 3300010167 | Bacteria | 12278 |
| 72 | Ga0466716_501010 | 3300042605 | Bacteria | 3885 |
| 73 | Ga0466722_133019 | 3300042609 | Unclassified | 2883 |
| 74 | Ga0466694_139788 | 3300042594 | Bacteria | 2342 |
| 75 | Ga0072941_1005991 | 3300005201 | Bacteria | 8325 |
| 76 | Ga0466712_072051 | 3300042614 | Bacteria | 23884 |
| 77 | Ga0466723_211837 | 3300042618 | Bacteria | 8397 |
| 78 | Ga0466723_364265 | 3300042618 | Bacteria | 16673 |
| 79 | Ga0466729_143876 | 3300042621 | Unclassified | 2444 |
| 80 | Ga0466733_007397 | 3300042659 | Bacteria | 3434 |
| 81 | Ga0466709_331234 | 3300042648 | Bacteria | 9370 |
| 82 | Ga0466708_015554 | 3300042652 | Bacteria | 30533 |
| 83 | Ga0123353_10284283 | 3300010167 | Bacteria | 2538 |
| 84 | Ga0466716_114793 | 3300042605 | Bacteria | 22083 |
| 85 | Ga0264413_122738 | 3300024493 | Bacteria | 4590 |
| 86 | Ga0466692_115606 | 3300042591 | Bacteria | 2199 |
| 87 | Ga0466691_209139 | 3300042593 | Bacteria | 9020 |
| 88 | JGI24703J35330_11741224 | 3300002501 | Bacteria | 3520 |
| 89 | Ga0072940_1019611 | 3300005200 | Bacteria | 11713 |
| 90 | Ga0466715_057623 | 3300042616 | Bacteria | 7552 |
| 91 | Ga0466718_057343 | 3300042617 | Bacteria | 5522 |
| 92 | Ga0466726_365482 | 3300042619 | Bacteria | 1839 |
| 93 | Ga0466705_120845 | 3300042612 | Bacteria | 5539 |
| 94 | Ga0466735_167931 | 3300042624 | Bacteria | 1465 |
| 95 | Ga0466703_013758 | 3300042636 | Bacteria | 5258 |
| 96 | Ga0466704_094942 | 3300042643 | Bacteria | 57318 |
| 97 | Ga0466704_343782 | 3300042643 | Bacteria | 17755 |
| 98 | Ga0466708_220002 | 3300042652 | Bacteria | 3896 |
| 99 | Ga0123357_10156715 | 3300009784 | Bacteria | 2744 |
| 100 | Ga0123355_10020532 | 3300009826 | Bacteria | 10553 |
| 101 | Ga0123355_10114031 | 3300009826 | Bacteria | 4214 |
| 102 | Ga0123355_10222549 | 3300009826 | Bacteria | 2711 |
| 103 | Ga0123353_10086006 | 3300010167 | Bacteria | 5064 |
| 104 | Ga0466707_064613 | 3300042601 | Bacteria | 2890 |
| 105 | Ga0466707_287266 | 3300042601 | Bacteria | 2132 |
| 106 | Ga0466707_389627 | 3300042601 | Bacteria | 1646 |
| 107 | Ga0466719_113646 | 3300042606 | Unclassified | 2613 |
| 108 | Ga0466691_108325 | 3300042593 | Bacteria | 6537 |
| 109 | Ga0466696_034713 | 3300042596 | Bacteria | 5220 |
| 110 | JGI24695J34938_10001213 | 3300002450 | Bacteria | 22849 |
| 111 | JGI24695J34938_10025786 | 3300002450 | Bacteria | 2804 |
| 112 | JGI24702J35022_10002110 | 3300002462 | Bacteria | 12275 |
| 113 | Ga0068305_10916328 | 3300005083 | Bacteria | 3655 |
| 114 | Ga0466712_047061 | 3300042614 | Bacteria | 14486 |
| 115 | Ga0466726_390944 | 3300042619 | Bacteria | 1897 |
| 116 | Ga0466728_223723 | 3300042620 | Bacteria | 3979 |
| 117 | Ga0466705_219458 | 3300042612 | Bacteria | 14353 |
| 118 | Ga0466733_196049 | 3300042659 | Bacteria | 14805 |
| 119 | Ga0466729_309375 | 3300042621 | Bacteria | 2689 |
| 120 | Ga0466735_186691 | 3300042624 | Bacteria | 9243 |
| 121 | Ga0466704_044581 | 3300042643 | Bacteria | 14955 |
| 122 | Ga0466708_062527 | 3300042652 | Bacteria | 36730 |
| 123 | Ga0466727_331114 | 3300042655 | Bacteria | 6501 |
| 124 | Ga0123353_10435414 | 3300010167 | Bacteria | 1937 |
| 125 | Ga0123353_10496053 | 3300010167 | Bacteria | 1781 |
| 126 | Ga0466707_302191 | 3300042601 | Bacteria | 41985 |
| 127 | Ga0466713_110759 | 3300042602 | Bacteria | 2660 |
| 128 | Ga0466719_207422 | 3300042606 | Bacteria | 16146 |
| 129 | Ga0466722_152482 | 3300042609 | Bacteria | 7586 |
| 130 | Ga0466698_003252 | 3300042610 | Bacteria | 17096 |
| 131 | Ga0456237_0002256 | 3300041968 | Unclassified | 3120 |
| 132 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 133 | Ga0466696_474966 | 3300042596 | Bacteria | 7751 |
| 134 | JGI24705J35276_12221912 | 3300002504 | Bacteria | 2378 |
| 135 | Ga0123357_10002662 | 3300009784 | Unclassified | 20095 |
| 136 | Ga0466723_325977 | 3300042618 | Bacteria | 2746 |
| 137 | Ga0466728_222275 | 3300042620 | Bacteria | 2803 |
| 138 | Ga0466703_199713 | 3300042636 | Bacteria | 1738 |
| 139 | Ga0123355_10001120 | 3300009826 | Bacteria | 37070 |
| 140 | Ga0123354_10093437 | 3300010882 | Bacteria | 4135 |
| 141 | Ga0123354_10142911 | 3300010882 | Unclassified | 2948 |
| 142 | Ga0466716_222007 | 3300042605 | Bacteria | 3642 |
| 143 | Ga0466719_180187 | 3300042606 | Bacteria | 25290 |
| 144 | Ga0466719_225450 | 3300042606 | Bacteria | 68670 |
| 145 | Ga0466720_110807 | 3300042607 | Bacteria | 1838 |
| 146 | Ga0466692_074461 | 3300042591 | Bacteria | 7859 |
| 147 | Ga0466691_036890 | 3300042593 | Bacteria | 8259 |
| 148 | Ga0466696_058664 | 3300042596 | Bacteria | 3602 |
| 149 | JGI24695J34938_10007268 | 3300002450 | Bacteria | 6522 |
| 150 | JGI24699J35502_11125420 | 3300002509 | Bacteria | 3797 |
| 151 | Ga0123357_10000406 | 3300009784 | Bacteria | 40984 |
| 152 | Ga0466705_530876 | 3300042612 | Bacteria | 3096 |
| 153 | Ga0466712_043020 | 3300042614 | Bacteria | 10399 |
| 154 | Ga0466712_058877 | 3300042614 | Bacteria | 25182 |
| 155 | Ga0466712_129938 | 3300042614 | Bacteria | 14577 |
| 156 | Ga0466711_243993 | 3300042615 | Bacteria | 10588 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.