Protein Family IF04696
Metagenome
Metatranscriptome
Isolate
193
Members
59
Samples
182
Scaffolds
186.75
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_146465|Ga0466692_146465_4039_4695
- Length
- 218 aa
- Sequence
- LHFTLADLVTDITQNASEAGANLVELEIDEGSSPDGGGREFRFLVRDNGKGMTREELVRAVDPFVTDGIKHPHRKVGLGIPFLIQTAEQSGGGCEIRSAKAGQPEAVWRTDGVSRNESPARPVPAGCAGTTTTAWFDTNNVDTPPVGDLPGMFRTILMFEGPADIRLRRSFKRADGTVREYQVRKMELAEALGNLEDTESLVLLGQYLRSLEEEGSGE
Sample Types
Isolate
5.7%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
2.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.3%
Kalotermitidae
25.5%
Unclassified
21.8%
Rhinotermitidae
3.6%
Termopsidae
1.8%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300021218 | Termite gut microbial communities from nest from French Guiana - FG16_L2_4 mRNA SA | Metatranscriptome | |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 40 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 41 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 42 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 51 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 52 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 59 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_160272 | 3300042614 | Bacteria | 17354 |
| 2 | Ga0466715_080105 | 3300042616 | Bacteria | 10394 |
| 3 | Ga0466718_002928 | 3300042617 | Bacteria | 11274 |
| 4 | JGI24698J34947_10117177 | 3300002449 | Bacteria | 1164 |
| 5 | JGI24698J34947_10171695 | 3300002449 | Bacteria | 877 |
| 6 | JGI24695J34938_10002570 | 3300002450 | Bacteria | 13685 |
| 7 | JGI24695J34938_10002886 | 3300002450 | Bacteria | 12512 |
| 8 | JGI24695J34938_10086707 | 3300002450 | Unclassified | 1288 |
| 9 | Ga0072941_1020782 | 3300005201 | Bacteria | 16950 |
| 10 | Ga0072941_1114226 | 3300005201 | Bacteria | 1159 |
| 11 | Ga0255786_1006912 | 3300022815 | Bacteria | 813 |
| 12 | Ga0264413_111425 | 3300024493 | Bacteria | 62805 |
| 13 | Ga0466694_141622 | 3300042594 | Bacteria | 6503 |
| 14 | Ga0123356_10000810 | 3300010049 | Bacteria | 34730 |
| 15 | Ga0123356_10922600 | 3300010049 | Bacteria | 1044 |
| 16 | Ga0123353_10179701 | 3300010167 | Bacteria | 3351 |
| 17 | Ga0123353_10397644 | 3300010167 | Bacteria | 2052 |
| 18 | Ga0466716_014085 | 3300042605 | Bacteria | 12433 |
| 19 | Ga0466721_370989 | 3300042608 | Bacteria | 1703 |
| 20 | Ga0466722_061334 | 3300042609 | Bacteria | 7926 |
| 21 | Ga0466702_254653 | 3300042635 | Bacteria | 1228 |
| 22 | Ga0466708_434035 | 3300042652 | Bacteria | 2459 |
| 23 | Ga0466705_114218 | 3300042612 | Bacteria | 3216 |
| 24 | Ga0466715_066722 | 3300042616 | Bacteria | 4414 |
| 25 | Ga0466723_027905 | 3300042618 | Bacteria | 2155 |
| 26 | Ga0466723_249816 | 3300042618 | Bacteria | 11759 |
| 27 | AustNasuHG_c1004651 | 3300000089 | Bacteria | 4927 |
| 28 | JGI24695J34938_10007397 | 3300002450 | Bacteria | 6434 |
| 29 | JGI24695J34938_10022251 | 3300002450 | Bacteria | 3082 |
| 30 | JGI24695J34938_10032043 | 3300002450 | Bacteria | 2432 |
| 31 | JGI24695J34938_10225107 | 3300002450 | Bacteria | 788 |
| 32 | Ga0072941_1021495 | 3300005201 | Bacteria | 4025 |
| 33 | Ga0415639_003968 | 3300038395 | Bacteria | 7986 |
| 34 | Ga0466690_374463 | 3300042590 | Bacteria | 1683 |
| 35 | Ga0466694_007865 | 3300042594 | Bacteria | 6750 |
| 36 | Ga0123356_10408096 | 3300010049 | Bacteria | 1498 |
| 37 | Ga0123356_10710426 | 3300010049 | Bacteria | 1174 |
| 38 | Ga0123356_11229969 | 3300010049 | Bacteria | 914 |
| 39 | Ga0123356_11291867 | 3300010049 | Bacteria | 893 |
| 40 | Ga0123353_10259767 | 3300010167 | Bacteria | 2684 |
| 41 | Ga0123353_10480613 | 3300010167 | Bacteria | 1818 |
| 42 | Ga0123353_10658835 | 3300010167 | Bacteria | 1480 |
| 43 | Ga0466707_202790 | 3300042601 | Bacteria | 2821 |
| 44 | Ga0466714_108328 | 3300042603 | Bacteria | 2123 |
| 45 | Ga0466716_203280 | 3300042605 | Bacteria | 1667 |
| 46 | Ga0466720_018527 | 3300042607 | Bacteria | 1635 |
| 47 | Ga0466720_078819 | 3300042607 | Bacteria | 3522 |
| 48 | Ga0466731_081847 | 3300042622 | Bacteria | 13431 |
| 49 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 50 | Ga0466705_209531 | 3300042612 | Bacteria | 2826 |
| 51 | Ga0466705_279555 | 3300042612 | Bacteria | 4227 |
| 52 | Ga0466712_048237 | 3300042614 | Bacteria | 20103 |
| 53 | Ga0466715_275529 | 3300042616 | Bacteria | 2583 |
| 54 | JGI24695J34938_10000187 | 3300002450 | Bacteria | 58138 |
| 55 | JGI24695J34938_10000417 | 3300002450 | Bacteria | 41418 |
| 56 | JGI24695J34938_10001047 | 3300002450 | Bacteria | 25078 |
| 57 | JGI24695J34938_10010577 | 3300002450 | Bacteria | 5039 |
| 58 | JGI24695J34938_10019467 | 3300002450 | Bacteria | 3364 |
| 59 | JGI24695J34938_10177780 | 3300002450 | Bacteria | 880 |
| 60 | Ga0068305_10001984 | 3300005083 | Bacteria | 5730 |
| 61 | Ga0072940_1039294 | 3300005200 | Bacteria | 2571 |
| 62 | Ga0223674_1008654 | 3300021235 | Bacteria | 2653 |
| 63 | Ga0415639_003925 | 3300038395 | Bacteria | 14811 |
| 64 | Ga0466690_172034 | 3300042590 | Bacteria | 4024 |
| 65 | Ga0466691_166946 | 3300042593 | Bacteria | 4596 |
| 66 | Ga0466691_213789 | 3300042593 | Bacteria | 8760 |
| 67 | Ga0123357_10018147 | 3300009784 | Bacteria | 9345 |
| 68 | Ga0123356_11370902 | 3300010049 | Bacteria | 868 |
| 69 | Ga0123356_11564970 | 3300010049 | Bacteria | 815 |
| 70 | Ga0466717_221085 | 3300042604 | Bacteria | 3403 |
| 71 | Ga0466716_291386 | 3300042605 | Bacteria | 11587 |
| 72 | Ga0466719_530355 | 3300042606 | Unclassified | 1660 |
| 73 | Ga0466720_060117 | 3300042607 | Bacteria | 13861 |
| 74 | Ga0466731_282262 | 3300042622 | Bacteria | 1867 |
| 75 | Ga0466708_090923 | 3300042652 | Bacteria | 5771 |
| 76 | Ga0466708_240268 | 3300042652 | Bacteria | 2682 |
| 77 | Ga0466732_234187 | 3300042656 | Bacteria | 4384 |
| 78 | Ga0466718_024751 | 3300042617 | Bacteria | 12817 |
| 79 | Ga0466723_212993 | 3300042618 | Bacteria | 5869 |
| 80 | AustNasuHG_c1003452 | 3300000089 | Bacteria | 5706 |
| 81 | JGI24698J34947_10000282 | 3300002449 | Bacteria | 21909 |
| 82 | JGI24695J34938_10008457 | 3300002450 | Bacteria | 5865 |
| 83 | Ga0072941_1005610 | 3300005201 | Bacteria | 18620 |
| 84 | Ga0074263_113059 | 3300005485 | Bacteria | 648 |
| 85 | Ga0415639_003970 | 3300038395 | Bacteria | 8310 |
| 86 | Ga0466692_022905 | 3300042591 | Bacteria | 1048 |
| 87 | Ga0466693_381378 | 3300042592 | Bacteria | 32518 |
| 88 | Ga0466699_089885 | 3300042597 | Bacteria | 2133 |
| 89 | Ga0466699_108046 | 3300042597 | Bacteria | 9479 |
| 90 | Ga0466699_259723 | 3300042597 | Bacteria | 1064 |
| 91 | Ga0466699_340903 | 3300042597 | Bacteria | 3805 |
| 92 | Ga0123356_10003143 | 3300010049 | Bacteria | 17393 |
| 93 | Ga0123356_10276112 | 3300010049 | Unclassified | 1773 |
| 94 | Ga0123356_11916624 | 3300010049 | Bacteria | 738 |
| 95 | Ga0466716_447097 | 3300042605 | Bacteria | 3464 |
| 96 | Ga0466720_083199 | 3300042607 | Bacteria | 2912 |
| 97 | Ga0466722_051765 | 3300042609 | Bacteria | 15340 |
| 98 | Ga0466704_000788 | 3300042643 | Bacteria | 3950 |
| 99 | Ga0466704_215734 | 3300042643 | Bacteria | 4329 |
| 100 | Ga0466709_225193 | 3300042648 | Bacteria | 12324 |
| 101 | Ga0466732_070748 | 3300042656 | Bacteria | 17433 |
| 102 | Ga0466705_485798 | 3300042612 | Bacteria | 5231 |
| 103 | Ga0466712_120111 | 3300042614 | Bacteria | 38676 |
| 104 | Ga0466715_162526 | 3300042616 | Bacteria | 4260 |
| 105 | Ga0466718_145161 | 3300042617 | Bacteria | 14928 |
| 106 | JGI24695J34938_10004502 | 3300002450 | Bacteria | 9116 |
| 107 | JGI24695J34938_10005383 | 3300002450 | Bacteria | 7992 |
| 108 | Ga0072940_1119370 | 3300005200 | Bacteria | 2516 |
| 109 | Ga0223684_1055283 | 3300021240 | Bacteria | 728 |
| 110 | Ga0415639_048271 | 3300038395 | Bacteria | 1225 |
| 111 | Ga0466690_254553 | 3300042590 | Bacteria | 1410 |
| 112 | Ga0466699_143416 | 3300042597 | Bacteria | 1649 |
| 113 | Ga0123356_11091985 | 3300010049 | Bacteria | 966 |
| 114 | Ga0123356_12266433 | 3300010049 | Bacteria | 679 |
| 115 | Ga0123353_10651075 | 3300010167 | Bacteria | 1491 |
| 116 | Ga0123353_10660566 | 3300010167 | Bacteria | 1477 |
| 117 | Ga0466700_267426 | 3300042600 | Bacteria | 1861 |
| 118 | Ga0466707_304852 | 3300042601 | Bacteria | 2664 |
| 119 | Ga0466702_032029 | 3300042635 | Bacteria | 2120 |
| 120 | Ga0466702_087416 | 3300042635 | Bacteria | 1580 |
| 121 | Ga0466708_127191 | 3300042652 | Bacteria | 2551 |
| 122 | Ga0466727_204890 | 3300042655 | Bacteria | 1451 |
| 123 | Ga0466712_196901 | 3300042614 | Bacteria | 2049 |
| 124 | Ga0466715_639561 | 3300042616 | Bacteria | 6241 |
| 125 | JGI24695J34938_10000191 | 3300002450 | Bacteria | 57182 |
| 126 | Ga0072941_1037844 | 3300005201 | Bacteria | 1962 |
| 127 | Ga0072941_1043620 | 3300005201 | Bacteria | 5372 |
| 128 | Ga0223679_102046 | 3300021218 | Bacteria | 779 |
| 129 | Ga0466692_018057 | 3300042591 | Bacteria | 1273 |
| 130 | Ga0466692_146465 | 3300042591 | Bacteria | 6037 |
| 131 | Ga0466691_227344 | 3300042593 | Bacteria | 8480 |
| 132 | Ga0466696_168452 | 3300042596 | Bacteria | 15050 |
| 133 | Ga0466699_009887 | 3300042597 | Bacteria | 7645 |
| 134 | Ga0123356_11047909 | 3300010049 | Bacteria | 985 |
| 135 | Ga0466700_140599 | 3300042600 | Bacteria | 7499 |
| 136 | Ga0466720_215763 | 3300042607 | Bacteria | 2475 |
| 137 | Ga0466721_281733 | 3300042608 | Bacteria | 1321 |
| 138 | Ga0466703_268197 | 3300042636 | Bacteria | 2192 |
| 139 | Ga0466708_409920 | 3300042652 | Bacteria | 3711 |
| 140 | Ga0466723_054000 | 3300042618 | Bacteria | 1595 |
| 141 | AustNasuHG_c1048873 | 3300000089 | Bacteria | 925 |
| 142 | JGI24695J34938_10002207 | 3300002450 | Bacteria | 15172 |
| 143 | JGI24695J34938_10002716 | 3300002450 | Bacteria | 13085 |
| 144 | JGI24695J34938_10019546 | 3300002450 | Bacteria | 3354 |
| 145 | JGI24695J34938_10104003 | 3300002450 | Bacteria | 1159 |
| 146 | Ga0072941_1017879 | 3300005201 | Bacteria | 9528 |
| 147 | Ga0415639_018920 | 3300038395 | Bacteria | 1664 |
| 148 | Ga0466691_018919 | 3300042593 | Bacteria | 5076 |
| 149 | Ga0466699_041020 | 3300042597 | Bacteria | 1453 |
| 150 | Ga0466699_067183 | 3300042597 | Bacteria | 1265 |
| 151 | Ga0466699_438306 | 3300042597 | Bacteria | 1379 |
| 152 | Ga0123354_10614160 | 3300010882 | Bacteria | 791 |
| 153 | Ga0466700_464047 | 3300042600 | Bacteria | 1976 |
| 154 | Ga0466720_079720 | 3300042607 | Bacteria | 6747 |
| 155 | Ga0466702_206258 | 3300042635 | Unclassified | 1174 |
| 156 | Ga0466702_291605 | 3300042635 | Bacteria | 1889 |
| 157 | Ga0466702_387914 | 3300042635 | Bacteria | 2663 |
| 158 | Ga0466709_335816 | 3300042648 | Bacteria | 3494 |
| 159 | Ga0466708_273900 | 3300042652 | Bacteria | 4003 |
| 160 | Ga0466732_002615 | 3300042656 | Bacteria | 9515 |
| 161 | Ga0466711_001871 | 3300042615 | Bacteria | 22067 |
| 162 | Ga0466718_082542 | 3300042617 | Bacteria | 7886 |
| 163 | Ga0466718_106473 | 3300042617 | Bacteria | 6076 |
| 164 | Ga0466728_007985 | 3300042620 | Bacteria | 1728 |
| 165 | Nasutiter_Contig02452 | 2030936001 | Bacteria | 5234 |
| 166 | JGI24698J34947_10012335 | 3300002449 | Unclassified | 4684 |
| 167 | JGI24698J34947_10021064 | 3300002449 | Bacteria | 3510 |
| 168 | JGI24695J34938_10006051 | 3300002450 | Bacteria | 7373 |
| 169 | Ga0072941_1071501 | 3300005201 | Bacteria | 1930 |
| 170 | Ga0466690_126364 | 3300042590 | Unclassified | 2995 |
| 171 | Ga0466691_142698 | 3300042593 | Bacteria | 3081 |
| 172 | Ga0466699_142759 | 3300042597 | Bacteria | 1110 |
| 173 | Ga0466699_234238 | 3300042597 | Bacteria | 37498 |
| 174 | Ga0466699_237289 | 3300042597 | Bacteria | 1721 |
| 175 | Ga0123356_10000688 | 3300010049 | Bacteria | 37446 |
| 176 | Ga0123356_10022815 | 3300010049 | Bacteria | 5903 |
| 177 | Ga0123356_10151750 | 3300010049 | Bacteria | 2301 |
| 178 | Ga0466719_465738 | 3300042606 | Bacteria | 2384 |
| 179 | Ga0466720_083368 | 3300042607 | Bacteria | 10066 |
| 180 | Ga0466720_193428 | 3300042607 | Bacteria | 2574 |
| 181 | Ga0466722_052891 | 3300042609 | Bacteria | 4566 |
| 182 | Ga0466709_197515 | 3300042648 | Bacteria | 7837 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.