Protein Family IF04683
Metagenome
Metatranscriptome
Isolate
185
Members
48
Samples
181
Scaffolds
130.37
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_125586|Ga0466692_125586_6060_6545
- Length
- 161 aa
- Sequence
- VKEERRKELHRKQRNAQKRRLGVKRDKIVFNHSRNLGIGTGRRKTAVARVYVRDGEGKIVVNGRELAAYFPQGEHAMMVRQPLMVTASENKFDVLINVYGGGANGQAGACRHGLARALCQVDQNNTVSLRNNGFLTRDPRMVERKKYGQRGARRRFQFSKR
Sample Types
Isolate
2.2%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
10.9%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
1
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 25 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0456237_0000949 | 3300041968 | Bacteria | 4559 |
| 2 | Ga0466692_021300 | 3300042591 | Bacteria | 25960 |
| 3 | Ga0466694_064362 | 3300042594 | Bacteria | 1073 |
| 4 | Ga0466696_181217 | 3300042596 | Bacteria | 2456 |
| 5 | Ga0466703_066242 | 3300042636 | Bacteria | 28541 |
| 6 | Ga0466703_066892 | 3300042636 | Bacteria | 1016 |
| 7 | Ga0466703_077819 | 3300042636 | Bacteria | 10722 |
| 8 | Ga0466703_109720 | 3300042636 | Unclassified | 1093 |
| 9 | Ga0466715_261542 | 3300042616 | Bacteria | 2537 |
| 10 | Ga0466715_460918 | 3300042616 | Bacteria | 1428 |
| 11 | Ga0466718_102216 | 3300042617 | Bacteria | 1775 |
| 12 | Ga0466726_165640 | 3300042619 | Unclassified | 1006 |
| 13 | Ga0466726_298654 | 3300042619 | Bacteria | 23143 |
| 14 | Ga0466728_038779 | 3300042620 | Bacteria | 4515 |
| 15 | Ga0123356_10995358 | 3300010049 | Bacteria | 1008 |
| 16 | Ga0466700_060176 | 3300042600 | Bacteria | 1169 |
| 17 | Ga0466700_086591 | 3300042600 | Bacteria | 2450 |
| 18 | Ga0466722_214329 | 3300042609 | Bacteria | 1435 |
| 19 | AustNasuHG_c1003138 | 3300000089 | Bacteria | 5960 |
| 20 | Ga0466705_100918 | 3300042612 | Bacteria | 10806 |
| 21 | Ga0466705_339216 | 3300042612 | Bacteria | 3366 |
| 22 | Ga0264413_109370 | 3300024493 | Bacteria | 7337 |
| 23 | Ga0466708_076899 | 3300042652 | Unclassified | 1407 |
| 24 | Ga0466727_011001 | 3300042655 | Bacteria | 2324 |
| 25 | Ga0466727_090183 | 3300042655 | Bacteria | 2030 |
| 26 | Ga0466727_257676 | 3300042655 | Bacteria | 2393 |
| 27 | Ga0466727_313130 | 3300042655 | Bacteria | 1160 |
| 28 | Ga0466727_346755 | 3300042655 | Bacteria | 1154 |
| 29 | Ga0466712_186571 | 3300042614 | Bacteria | 3456 |
| 30 | Ga0466711_278250 | 3300042615 | Bacteria | 27735 |
| 31 | Ga0466715_163596 | 3300042616 | Bacteria | 4928 |
| 32 | Ga0466715_425219 | 3300042616 | Bacteria | 5108 |
| 33 | Ga0466718_126291 | 3300042617 | Bacteria | 1041 |
| 34 | Ga0466726_007091 | 3300042619 | Bacteria | 2025 |
| 35 | Ga0466726_016848 | 3300042619 | Bacteria | 1917 |
| 36 | Ga0466726_192971 | 3300042619 | Bacteria | 1151 |
| 37 | Ga0466728_055309 | 3300042620 | Bacteria | 22105 |
| 38 | Ga0123357_10154835 | 3300009784 | Bacteria | 2768 |
| 39 | Ga0466716_007473 | 3300042605 | Unclassified | 1701 |
| 40 | Ga0466716_273004 | 3300042605 | Unclassified | 1782 |
| 41 | Ga0466698_237043 | 3300042610 | Bacteria | 1151 |
| 42 | AustNasuHG_c1003330 | 3300000089 | Bacteria | 5798 |
| 43 | Ga0072941_1112070 | 3300005201 | Unclassified | 4231 |
| 44 | Ga0466705_061293 | 3300042612 | Unclassified | 8466 |
| 45 | Ga0466705_183139 | 3300042612 | Bacteria | 11730 |
| 46 | Ga0466705_317172 | 3300042612 | Bacteria | 2293 |
| 47 | Ga0264413_100627 | 3300024493 | Bacteria | 25261 |
| 48 | Ga0466690_080446 | 3300042590 | Bacteria | 4915 |
| 49 | Ga0466691_024662 | 3300042593 | Bacteria | 3847 |
| 50 | Ga0466691_052015 | 3300042593 | Bacteria | 8788 |
| 51 | Ga0466696_213971 | 3300042596 | Bacteria | 3489 |
| 52 | Ga0466696_450027 | 3300042596 | Bacteria | 14082 |
| 53 | Ga0466699_110498 | 3300042597 | Bacteria | 24920 |
| 54 | Ga0466703_423387 | 3300042636 | Bacteria | 3354 |
| 55 | Ga0466709_076737 | 3300042648 | Unclassified | 1196 |
| 56 | Ga0466718_132798 | 3300042617 | Unclassified | 4548 |
| 57 | Ga0466723_051300 | 3300042618 | Bacteria | 3933 |
| 58 | Ga0123354_10861591 | 3300010882 | Bacteria | 600 |
| 59 | Ga0466701_016726 | 3300042598 | Bacteria | 1585 |
| 60 | Ga0466716_415022 | 3300042605 | Bacteria | 1902 |
| 61 | Ga0466705_078763 | 3300042612 | Bacteria | 55629 |
| 62 | Ga0466692_097790 | 3300042591 | Unclassified | 4378 |
| 63 | Ga0466691_023145 | 3300042593 | Bacteria | 4420 |
| 64 | Ga0466695_185288 | 3300042595 | Bacteria | 6160 |
| 65 | Ga0466695_188571 | 3300042595 | Bacteria | 1513 |
| 66 | Ga0466699_050869 | 3300042597 | Bacteria | 3350 |
| 67 | Ga0466704_144934 | 3300042643 | Unclassified | 1322 |
| 68 | Ga0466723_038818 | 3300042618 | Unclassified | 2943 |
| 69 | Ga0466723_062430 | 3300042618 | Bacteria | 3321 |
| 70 | Ga0466726_448891 | 3300042619 | Bacteria | 2803 |
| 71 | Ga0466719_185353 | 3300042606 | Unclassified | 1746 |
| 72 | Ga0466722_266387 | 3300042609 | Bacteria | 22057 |
| 73 | Ga0466698_146301 | 3300042610 | Bacteria | 1060 |
| 74 | Nasutiter_Contig02971 | 2030936001 | Unclassified | 550 |
| 75 | JGI24698J34947_10105988 | 3300002449 | Unclassified | 1251 |
| 76 | Ga0264413_124462 | 3300024493 | Bacteria | 3850 |
| 77 | Ga0466690_379176 | 3300042590 | Unclassified | 1455 |
| 78 | Ga0466692_029680 | 3300042591 | Bacteria | 1537 |
| 79 | Ga0466696_468120 | 3300042596 | Unclassified | 1184 |
| 80 | Ga0466709_024447 | 3300042648 | Bacteria | 1137 |
| 81 | Ga0466708_072400 | 3300042652 | Bacteria | 3393 |
| 82 | Ga0466708_116866 | 3300042652 | Unclassified | 1609 |
| 83 | Ga0466727_307253 | 3300042655 | Bacteria | 12397 |
| 84 | Ga0466705_505171 | 3300042612 | Unclassified | 6847 |
| 85 | Ga0466712_067822 | 3300042614 | Bacteria | 8623 |
| 86 | Ga0466723_176242 | 3300042618 | Bacteria | 78804 |
| 87 | Ga0466723_276530 | 3300042618 | Bacteria | 4371 |
| 88 | Ga0466723_291799 | 3300042618 | Bacteria | 3414 |
| 89 | Ga0466723_336694 | 3300042618 | Bacteria | 2020 |
| 90 | Ga0466726_043014 | 3300042619 | Bacteria | 2288 |
| 91 | Ga0466726_116578 | 3300042619 | Bacteria | 2906 |
| 92 | Ga0466726_334369 | 3300042619 | Bacteria | 2946 |
| 93 | Ga0466716_062815 | 3300042605 | Unclassified | 5193 |
| 94 | Ga0466716_103208 | 3300042605 | Bacteria | 2127 |
| 95 | Ga0466720_001741 | 3300042607 | Bacteria | 10607 |
| 96 | Ga0466722_063652 | 3300042609 | Bacteria | 9554 |
| 97 | Ga0466722_072524 | 3300042609 | Bacteria | 2444 |
| 98 | Ga0466690_046507 | 3300042590 | Unclassified | 11746 |
| 99 | Ga0466692_141338 | 3300042591 | Bacteria | 2551 |
| 100 | Ga0466694_215995 | 3300042594 | Bacteria | 3614 |
| 101 | Ga0466699_006172 | 3300042597 | Bacteria | 1456 |
| 102 | Ga0466699_150624 | 3300042597 | Bacteria | 2618 |
| 103 | Ga0466699_191763 | 3300042597 | Bacteria | 1146 |
| 104 | Ga0466729_238662 | 3300042621 | Bacteria | 1072 |
| 105 | Ga0466709_246849 | 3300042648 | Bacteria | 13349 |
| 106 | Ga0466709_293327 | 3300042648 | Unclassified | 2801 |
| 107 | Ga0466708_101153 | 3300042652 | Bacteria | 1883 |
| 108 | Ga0466715_141957 | 3300042616 | Bacteria | 2092 |
| 109 | Ga0466723_205306 | 3300042618 | Bacteria | 2526 |
| 110 | Ga0466723_231352 | 3300042618 | Unclassified | 2889 |
| 111 | Ga0466728_048586 | 3300042620 | Bacteria | 21977 |
| 112 | Ga0466728_483364 | 3300042620 | Bacteria | 3705 |
| 113 | Ga0466706_074266 | 3300042599 | Bacteria | 2605 |
| 114 | Ga0466717_187199 | 3300042604 | Bacteria | 1441 |
| 115 | Ga0466716_480937 | 3300042605 | Unclassified | 3111 |
| 116 | Ga0466719_378679 | 3300042606 | Unclassified | 1015 |
| 117 | Ga0466720_137838 | 3300042607 | Bacteria | 19324 |
| 118 | Ga0466722_011883 | 3300042609 | Bacteria | 1780 |
| 119 | JGI24698J34947_10070548 | 3300002449 | Bacteria | 1681 |
| 120 | Ga0068302_10687135 | 3300005071 | Unclassified | 806 |
| 121 | Ga0072941_1021636 | 3300005201 | Bacteria | 6747 |
| 122 | Ga0466705_067453 | 3300042612 | Bacteria | 4059 |
| 123 | Ga0466732_424145 | 3300042656 | Unclassified | 4615 |
| 124 | Ga0223682_1025208 | 3300021231 | Bacteria | 641 |
| 125 | Ga0456237_0023096 | 3300041968 | Bacteria | 853 |
| 126 | Ga0466692_169590 | 3300042591 | Bacteria | 12793 |
| 127 | Ga0466691_068250 | 3300042593 | Bacteria | 7204 |
| 128 | Ga0466696_085822 | 3300042596 | Bacteria | 4210 |
| 129 | Ga0466696_153584 | 3300042596 | Unclassified | 2338 |
| 130 | Ga0466699_049759 | 3300042597 | Bacteria | 14249 |
| 131 | Ga0466704_019259 | 3300042643 | Bacteria | 13069 |
| 132 | Ga0466709_064273 | 3300042648 | Bacteria | 18619 |
| 133 | Ga0466709_304645 | 3300042648 | Bacteria | 1150 |
| 134 | Ga0466708_102025 | 3300042652 | Bacteria | 25488 |
| 135 | Ga0466708_168191 | 3300042652 | Unclassified | 1139 |
| 136 | Ga0466727_315678 | 3300042655 | Unclassified | 1067 |
| 137 | Ga0466705_524828 | 3300042612 | Bacteria | 4197 |
| 138 | Ga0466712_298586 | 3300042614 | Bacteria | 4659 |
| 139 | Ga0466711_405639 | 3300042615 | Bacteria | 2170 |
| 140 | Ga0466711_445344 | 3300042615 | Bacteria | 19342 |
| 141 | Ga0466715_140064 | 3300042616 | Unclassified | 3469 |
| 142 | Ga0466718_052309 | 3300042617 | Bacteria | 39851 |
| 143 | Ga0466718_056981 | 3300042617 | Bacteria | 24369 |
| 144 | Ga0466723_053478 | 3300042618 | Bacteria | 7378 |
| 145 | Ga0466726_252273 | 3300042619 | Bacteria | 4958 |
| 146 | Ga0466728_153924 | 3300042620 | Bacteria | 1289 |
| 147 | Ga0466728_274020 | 3300042620 | Unclassified | 4617 |
| 148 | Ga0466706_149779 | 3300042599 | Bacteria | 3224 |
| 149 | Ga0466707_158312 | 3300042601 | Bacteria | 2237 |
| 150 | Ga0466722_217400 | 3300042609 | Bacteria | 11931 |
| 151 | Ga0072941_1001255 | 3300005201 | Bacteria | 90205 |
| 152 | Ga0072941_1008947 | 3300005201 | Unclassified | 11764 |
| 153 | Ga0466690_096961 | 3300042590 | Bacteria | 5877 |
| 154 | Ga0466690_233376 | 3300042590 | Bacteria | 2407 |
| 155 | Ga0466692_125586 | 3300042591 | Bacteria | 17367 |
| 156 | Ga0466691_207273 | 3300042593 | Bacteria | 9872 |
| 157 | Ga0466696_022424 | 3300042596 | Bacteria | 31367 |
| 158 | Ga0466696_504574 | 3300042596 | Bacteria | 1744 |
| 159 | Ga0466699_345983 | 3300042597 | Bacteria | 2667 |
| 160 | Ga0466704_449334 | 3300042643 | Unclassified | 3036 |
| 161 | Ga0466711_148187 | 3300042615 | Bacteria | 2503 |
| 162 | Ga0466711_255171 | 3300042615 | Bacteria | 13460 |
| 163 | Ga0466715_113686 | 3300042616 | Bacteria | 5272 |
| 164 | Ga0466715_125648 | 3300042616 | Bacteria | 7804 |
| 165 | Ga0466715_237828 | 3300042616 | Bacteria | 20065 |
| 166 | Ga0466718_023820 | 3300042617 | Bacteria | 37871 |
| 167 | Ga0466718_060307 | 3300042617 | Bacteria | 11184 |
| 168 | Ga0466723_280732 | 3300042618 | Unclassified | 4365 |
| 169 | Ga0466726_208467 | 3300042619 | Bacteria | 2221 |
| 170 | Ga0466726_372349 | 3300042619 | Bacteria | 1447 |
| 171 | Ga0123356_11575966 | 3300010049 | Bacteria | 812 |
| 172 | Ga0123354_10851653 | 3300010882 | Bacteria | 605 |
| 173 | Ga0466700_299636 | 3300042600 | Viruses | 2317 |
| 174 | Ga0466707_166765 | 3300042601 | Bacteria | 3244 |
| 175 | Ga0466719_052235 | 3300042606 | Unclassified | 2760 |
| 176 | Ga0466719_475697 | 3300042606 | Bacteria | 1267 |
| 177 | Ga0466722_013464 | 3300042609 | Bacteria | 2399 |
| 178 | Ga0466722_121709 | 3300042609 | Bacteria | 6663 |
| 179 | JGI24698J34947_10065771 | 3300002449 | Bacteria | 1766 |
| 180 | JGI24702J35022_10014926 | 3300002462 | Bacteria | 4279 |
| 181 | Ga0072941_1012321 | 3300005201 | Unclassified | 1422 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00380 | Ribosomal_S9 | Ribosomal protein S9/S16 | 41 | 161 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.