Protein Family IF04655
Metagenome
Isolate
325
Members
89
Samples
282
Scaffolds
525.79
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_081030|Ga0466692_081030_6126_7832
- Length
- 568 aa
- Sequence
- LQQRINQLAVFIIIKKTGMSELTNEIQRRRTFAIISHPDAGKTTLTEKLLLFGGAIHVAGAVKSNKIKKTATSDWMEIEKQRGISVATSVMGFDYNDHKINILDTPGHQDFAEDTYRTLTAVDSVIIVVDIAKGVEAQTRKLMEVCRMRKTPVMIFVNKMDRDGKDPFDLLDELEQELQIHVRPLSWPIEMGAKFKGVYNIYEEKLDLYTPSKQTITESVEFKDLDNPDLEKHIGEKEAEKLRADLELIEGVYEPLPPRPLKGEQGNKLDSDTAAKSPLGDLGVKYLKGDLAPVFFGSALNNFGVKELLDCFIQIAPSPRSVVAEERTVNPEDTFSGFIFKIHANMDPNHRSCIAFLKICSGKFERNANYKHVRFDKMMKFSQATAFMAQKKETVDEAFAGDIIGLPDTGNFKIGDTLTSGEILHFKGLPSFSPEMFKYIENADPMKTKQLQKGVDQLMDEGVAQLFTNQYNGRKIIGTVGQLQFEVIQYRLLHEYGAQCRWEPLHLYKACWIESDSPEELENFKKRKYQYMALDKQEREVFLADSAYVLQMAQQDFPKIRFHFSSEF
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.2%
Termitidae
20.7%
Unclassified
16.1%
Kalotermitidae
16.1%
Rhinotermitidae
4.6%
Passalidae
3.4%
Termopsidae
3.4%
Hydrophilidae
2.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
316
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 3 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 4 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 5 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 6 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 7 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 19 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 20 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 21 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 22 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 23 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 24 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 25 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 34 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 35 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 36 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 37 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 38 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 39 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 43 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 49 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 55 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 56 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 57 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 58 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 59 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 60 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 61 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 64 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 65 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 66 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 67 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 68 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 69 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 70 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 71 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 72 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 73 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 74 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 75 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 76 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 79 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 80 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 81 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 82 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 83 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 84 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 85 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 86 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 87 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 88 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 89 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10107397 | 3300010882 | Unclassified | 3718 |
| 2 | Ga0466705_351223 | 3300042612 | Bacteria | 3510 |
| 3 | Ga0466733_033275 | 3300042659 | Bacteria | 24290 |
| 4 | Ga0466733_216132 | 3300042659 | Bacteria | 221678 |
| 5 | 2227463519 | 2225789004 | Bacteria | 25632 |
| 6 | IMNBL1DRAFT_c0000750 | 3300000062 | Unclassified | 25698 |
| 7 | Ga0123357_10002736 | 3300009784 | Bacteria | 19873 |
| 8 | Ga0466690_213257 | 3300042590 | Bacteria | 57182 |
| 9 | Ga0466692_100663 | 3300042591 | Bacteria | 44250 |
| 10 | Ga0466696_086191 | 3300042596 | Bacteria | 4596 |
| 11 | Ga0466696_173502 | 3300042596 | Bacteria | 2253 |
| 12 | Ga0466711_161975 | 3300042615 | Bacteria | 14160 |
| 13 | Ga0466715_297363 | 3300042616 | Bacteria | 14964 |
| 14 | Ga0466728_014003 | 3300042620 | Bacteria | 6205 |
| 15 | Ga0466735_068893 | 3300042624 | Bacteria | 4792 |
| 16 | Ga0466735_168858 | 3300042624 | Bacteria | 6830 |
| 17 | Ga0466735_173317 | 3300042624 | Bacteria | 10483 |
| 18 | Ga0466703_009428 | 3300042636 | Bacteria | 4387 |
| 19 | Ga0466703_086631 | 3300042636 | Bacteria | 6942 |
| 20 | Ga0466703_104167 | 3300042636 | Bacteria | 5470 |
| 21 | Ga0466704_095314 | 3300042643 | Bacteria | 11196 |
| 22 | Ga0466704_113583 | 3300042643 | Bacteria | 3388 |
| 23 | Ga0466704_177242 | 3300042643 | Bacteria | 38548 |
| 24 | Ga0466704_276034 | 3300042643 | Bacteria | 4021 |
| 25 | Ga0466709_015908 | 3300042648 | Bacteria | 26155 |
| 26 | Ga0466709_299438 | 3300042648 | Bacteria | 3919 |
| 27 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 28 | Ga0466707_189757 | 3300042601 | Bacteria | 4863 |
| 29 | Ga0466714_141473 | 3300042603 | Bacteria | 59209 |
| 30 | Ga0466716_381543 | 3300042605 | Bacteria | 3074 |
| 31 | Ga0123357_10006609 | 3300009784 | Bacteria | 14192 |
| 32 | Ga0123356_10042644 | 3300010049 | Bacteria | 4225 |
| 33 | Ga0123354_10015203 | 3300010882 | Unclassified | 12008 |
| 34 | Ga0466732_028661 | 3300042656 | Bacteria | 90899 |
| 35 | IMNBL1DRAFT_c0000979 | 3300000062 | Bacteria | 22035 |
| 36 | IMNBL1DRAFT_c0001668 | 3300000062 | Bacteria | 16402 |
| 37 | JGI24702J35022_10005014 | 3300002462 | Bacteria | 7810 |
| 38 | JGI24699J35502_11133963 | 3300002509 | Bacteria | 21757 |
| 39 | JGI24696J40584_12960772 | 3300002834 | Bacteria | 8458 |
| 40 | Ga0466690_100895 | 3300042590 | Bacteria | 21373 |
| 41 | Ga0466690_234657 | 3300042590 | Bacteria | 17970 |
| 42 | Ga0466692_052734 | 3300042591 | Bacteria | 48659 |
| 43 | Ga0466692_176669 | 3300042591 | Bacteria | 77723 |
| 44 | Ga0466693_133907 | 3300042592 | Bacteria | 1886 |
| 45 | Ga0466710_262544 | 3300042613 | Unclassified | 2374 |
| 46 | Ga0466711_220444 | 3300042615 | Bacteria | 19427 |
| 47 | Ga0466711_233249 | 3300042615 | Bacteria | 3041 |
| 48 | Ga0466715_424279 | 3300042616 | Bacteria | 10463 |
| 49 | Ga0466723_216140 | 3300042618 | Bacteria | 9383 |
| 50 | Ga0466726_023101 | 3300042619 | Bacteria | 1545 |
| 51 | Ga0466728_187576 | 3300042620 | Bacteria | 41986 |
| 52 | Ga0466729_002994 | 3300042621 | Bacteria | 13494 |
| 53 | Ga0466703_084735 | 3300042636 | Bacteria | 6570 |
| 54 | Ga0466704_155344 | 3300042643 | Bacteria | 13326 |
| 55 | Ga0466709_008034 | 3300042648 | Bacteria | 22082 |
| 56 | Ga0466708_202046 | 3300042652 | Bacteria | 11546 |
| 57 | Ga0466708_352021 | 3300042652 | Bacteria | 35380 |
| 58 | Ga0466727_129276 | 3300042655 | Bacteria | 6855 |
| 59 | Ga0466701_023633 | 3300042598 | Bacteria | 21206 |
| 60 | Ga0466706_080163 | 3300042599 | Bacteria | 1946 |
| 61 | Ga0466706_159070 | 3300042599 | Bacteria | 3972 |
| 62 | Ga0466700_250149 | 3300042600 | Bacteria | 6581 |
| 63 | Ga0466713_035478 | 3300042602 | Bacteria | 46123 |
| 64 | Ga0466713_089856 | 3300042602 | Bacteria | 11701 |
| 65 | Ga0466716_193489 | 3300042605 | Bacteria | 5123 |
| 66 | Ga0466716_220507 | 3300042605 | Bacteria | 7082 |
| 67 | Ga0466716_333201 | 3300042605 | Bacteria | 7407 |
| 68 | Ga0466719_057060 | 3300042606 | Bacteria | 11164 |
| 69 | Ga0466719_092057 | 3300042606 | Bacteria | 9419 |
| 70 | Ga0466722_112548 | 3300042609 | Bacteria | 6015 |
| 71 | Ga0123357_10195044 | 3300009784 | Bacteria | 2322 |
| 72 | Ga0123354_10024085 | 3300010882 | Bacteria | 9605 |
| 73 | Ga0466733_030534 | 3300042659 | Bacteria | 73502 |
| 74 | Ga0466733_139867 | 3300042659 | Bacteria | 8218 |
| 75 | Ga0466733_215369 | 3300042659 | Bacteria | 7958 |
| 76 | 2227100252 | 2225789004 | Bacteria | 9622 |
| 77 | JGI24702J35022_10000070 | 3300002462 | Bacteria | 44433 |
| 78 | JGI24702J35022_10003380 | 3300002462 | Bacteria | 9636 |
| 79 | JGI24699J35502_11134091 | 3300002509 | Bacteria | 29759 |
| 80 | Ga0123357_10002521 | 3300009784 | Bacteria | 20500 |
| 81 | Ga0466691_131230 | 3300042593 | Bacteria | 1808 |
| 82 | Ga0466705_389617 | 3300042612 | Bacteria | 4011 |
| 83 | Ga0466705_508803 | 3300042612 | Bacteria | 5586 |
| 84 | Ga0466711_304746 | 3300042615 | Bacteria | 20552 |
| 85 | Ga0466715_017519 | 3300042616 | Bacteria | 14037 |
| 86 | Ga0466715_051462 | 3300042616 | Bacteria | 15965 |
| 87 | Ga0466715_360546 | 3300042616 | Bacteria | 3228 |
| 88 | Ga0466715_483459 | 3300042616 | Bacteria | 9809 |
| 89 | Ga0466723_215653 | 3300042618 | Bacteria | 6042 |
| 90 | Ga0466723_344707 | 3300042618 | Bacteria | 4768 |
| 91 | Ga0466728_216023 | 3300042620 | Bacteria | 3927 |
| 92 | Ga0466703_122336 | 3300042636 | Bacteria | 17647 |
| 93 | Ga0466703_387349 | 3300042636 | Bacteria | 8544 |
| 94 | Ga0466704_339615 | 3300042643 | Bacteria | 9464 |
| 95 | Ga0466727_032376 | 3300042655 | Bacteria | 52244 |
| 96 | Ga0466727_078580 | 3300042655 | Bacteria | 23415 |
| 97 | Ga0466727_271364 | 3300042655 | Bacteria | 3071 |
| 98 | Ga0466713_077069 | 3300042602 | Bacteria | 26251 |
| 99 | Ga0466713_079736 | 3300042602 | Bacteria | 32873 |
| 100 | Ga0466713_128443 | 3300042602 | Bacteria | 30120 |
| 101 | Ga0466716_370239 | 3300042605 | Bacteria | 44961 |
| 102 | Ga0466719_128548 | 3300042606 | Bacteria | 13431 |
| 103 | Ga0466722_035577 | 3300042609 | Bacteria | 34205 |
| 104 | Ga0123354_10061764 | 3300010882 | Bacteria | 5526 |
| 105 | Ga0466733_006567 | 3300042659 | Bacteria | 10919 |
| 106 | Ga0466733_103421 | 3300042659 | Bacteria | 32380 |
| 107 | JGI24699J35502_11133700 | 3300002509 | Bacteria | 13820 |
| 108 | Ga0466690_267994 | 3300042590 | Bacteria | 2539 |
| 109 | Ga0466690_281959 | 3300042590 | Bacteria | 1437 |
| 110 | Ga0466694_357764 | 3300042594 | Bacteria | 2022 |
| 111 | Ga0466696_374576 | 3300042596 | Bacteria | 10587 |
| 112 | Ga0466710_395167 | 3300042613 | Bacteria | 12791 |
| 113 | Ga0466715_166980 | 3300042616 | Bacteria | 8459 |
| 114 | Ga0466715_205600 | 3300042616 | Bacteria | 15958 |
| 115 | Ga0466715_226183 | 3300042616 | Bacteria | 19883 |
| 116 | Ga0466715_312297 | 3300042616 | Bacteria | 2566 |
| 117 | Ga0466723_019917 | 3300042618 | Bacteria | 20700 |
| 118 | Ga0466726_064816 | 3300042619 | Bacteria | 21111 |
| 119 | Ga0466728_403020 | 3300042620 | Bacteria | 3913 |
| 120 | Ga0466703_272151 | 3300042636 | Bacteria | 11620 |
| 121 | Ga0466704_031634 | 3300042643 | Bacteria | 25951 |
| 122 | Ga0466727_206495 | 3300042655 | Bacteria | 1691 |
| 123 | Ga0466700_419351 | 3300042600 | Bacteria | 22548 |
| 124 | Ga0466707_375210 | 3300042601 | Bacteria | 8777 |
| 125 | Ga0466716_103571 | 3300042605 | Bacteria | 8889 |
| 126 | Ga0466716_447118 | 3300042605 | Bacteria | 3426 |
| 127 | Ga0466719_486616 | 3300042606 | Bacteria | 3630 |
| 128 | Ga0466722_113221 | 3300042609 | Bacteria | 26857 |
| 129 | Ga0123357_10024861 | 3300009784 | Bacteria | 8075 |
| 130 | Ga0123354_10103249 | 3300010882 | Bacteria | 3835 |
| 131 | 2227008140 | 2225789003 | Bacteria | 25147 |
| 132 | 2227136369 | 2225789004 | Bacteria | 8839 |
| 133 | 2227490212 | 2225789004 | Unclassified | 4110 |
| 134 | IMNBL1DRAFT_c0000232 | 3300000062 | Bacteria | 48886 |
| 135 | JGI24699J35502_11134119 | 3300002509 | Bacteria | 33315 |
| 136 | Ga0068305_10020271 | 3300005083 | Bacteria | 17549 |
| 137 | Ga0068305_10050329 | 3300005083 | Bacteria | 16611 |
| 138 | Ga0466690_120762 | 3300042590 | Bacteria | 8697 |
| 139 | Ga0466690_189558 | 3300042590 | Bacteria | 10081 |
| 140 | Ga0466691_064595 | 3300042593 | Bacteria | 3484 |
| 141 | Ga0466696_117408 | 3300042596 | Bacteria | 11606 |
| 142 | Ga0466696_260993 | 3300042596 | Bacteria | 16709 |
| 143 | Ga0466705_432039 | 3300042612 | Bacteria | 5957 |
| 144 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 145 | Ga0466711_087036 | 3300042615 | Bacteria | 2285 |
| 146 | Ga0466711_144796 | 3300042615 | Bacteria | 8254 |
| 147 | Ga0466711_243098 | 3300042615 | Bacteria | 31377 |
| 148 | Ga0466715_026005 | 3300042616 | Bacteria | 29467 |
| 149 | Ga0466715_045727 | 3300042616 | Bacteria | 16867 |
| 150 | Ga0466715_085619 | 3300042616 | Bacteria | 17658 |
| 151 | Ga0466715_170778 | 3300042616 | Bacteria | 8967 |
| 152 | Ga0466715_332974 | 3300042616 | Bacteria | 9767 |
| 153 | Ga0466715_464975 | 3300042616 | Bacteria | 101862 |
| 154 | Ga0466723_170931 | 3300042618 | Bacteria | 10738 |
| 155 | Ga0466723_212424 | 3300042618 | Bacteria | 14113 |
| 156 | Ga0466729_069001 | 3300042621 | Bacteria | 2618 |
| 157 | Ga0466729_142747 | 3300042621 | Bacteria | 4593 |
| 158 | Ga0466729_207255 | 3300042621 | Bacteria | 1787 |
| 159 | Ga0466734_120756 | 3300042623 | Bacteria | 2161 |
| 160 | Ga0466735_174412 | 3300042624 | Bacteria | 6616 |
| 161 | Ga0466703_288753 | 3300042636 | Bacteria | 3172 |
| 162 | Ga0466704_294530 | 3300042643 | Bacteria | 12975 |
| 163 | Ga0466704_503038 | 3300042643 | Bacteria | 36703 |
| 164 | Ga0466706_255935 | 3300042599 | Bacteria | 48242 |
| 165 | Ga0466707_223639 | 3300042601 | Bacteria | 7215 |
| 166 | Ga0466713_063067 | 3300042602 | Bacteria | 116971 |
| 167 | Ga0466713_073020 | 3300042602 | Bacteria | 13986 |
| 168 | Ga0466719_015304 | 3300042606 | Unclassified | 18094 |
| 169 | Ga0466719_499915 | 3300042606 | Bacteria | 9533 |
| 170 | Ga0123357_10069510 | 3300009784 | Unclassified | 4680 |
| 171 | Ga0123356_10043117 | 3300010049 | Bacteria | 4201 |
| 172 | Ga0123354_10028237 | 3300010882 | Bacteria | 8837 |
| 173 | 2227496571 | 2225789004 | Unclassified | 3920 |
| 174 | IMNBL1DRAFT_c0002513 | 3300000062 | Bacteria | 12705 |
| 175 | JGI24702J35022_10025695 | 3300002462 | Bacteria | 3175 |
| 176 | Ga0072941_1354629 | 3300005201 | Bacteria | 2090 |
| 177 | Ga0123357_10001502 | 3300009784 | Bacteria | 24813 |
| 178 | Ga0466692_081030 | 3300042591 | Bacteria | 11624 |
| 179 | Ga0466691_103599 | 3300042593 | Bacteria | 15504 |
| 180 | Ga0466691_116151 | 3300042593 | Bacteria | 19331 |
| 181 | Ga0466691_169164 | 3300042593 | Bacteria | 2434 |
| 182 | Ga0466696_044827 | 3300042596 | Bacteria | 9772 |
| 183 | Ga0466711_073849 | 3300042615 | Bacteria | 19235 |
| 184 | Ga0466711_189433 | 3300042615 | Bacteria | 38634 |
| 185 | Ga0466723_219073 | 3300042618 | Bacteria | 2252 |
| 186 | Ga0466726_416594 | 3300042619 | Bacteria | 8197 |
| 187 | Ga0466728_022168 | 3300042620 | Bacteria | 15404 |
| 188 | Ga0466728_286302 | 3300042620 | Bacteria | 16632 |
| 189 | Ga0466729_025004 | 3300042621 | Bacteria | 2159 |
| 190 | Ga0466735_053167 | 3300042624 | Bacteria | 12883 |
| 191 | Ga0466703_069211 | 3300042636 | Bacteria | 15429 |
| 192 | Ga0466703_334674 | 3300042636 | Bacteria | 13549 |
| 193 | Ga0466704_004254 | 3300042643 | Bacteria | 8540 |
| 194 | Ga0466704_040126 | 3300042643 | Bacteria | 12025 |
| 195 | Ga0466704_075296 | 3300042643 | Bacteria | 42602 |
| 196 | Ga0466704_500251 | 3300042643 | Bacteria | 19687 |
| 197 | Ga0466709_181108 | 3300042648 | Bacteria | 5370 |
| 198 | Ga0466709_339449 | 3300042648 | Bacteria | 12753 |
| 199 | Ga0466725_414518 | 3300042654 | Bacteria | 3892 |
| 200 | Ga0466727_345364 | 3300042655 | Bacteria | 11646 |
| 201 | Ga0466701_091876 | 3300042598 | Bacteria | 15981 |
| 202 | Ga0466706_063588 | 3300042599 | Bacteria | 28133 |
| 203 | Ga0466706_218581 | 3300042599 | Bacteria | 6070 |
| 204 | Ga0466707_114561 | 3300042601 | Bacteria | 14713 |
| 205 | Ga0466707_122292 | 3300042601 | Bacteria | 21068 |
| 206 | Ga0466707_375905 | 3300042601 | Bacteria | 21271 |
| 207 | Ga0466713_041894 | 3300042602 | Bacteria | 97930 |
| 208 | Ga0466716_100697 | 3300042605 | Bacteria | 28022 |
| 209 | Ga0466716_200956 | 3300042605 | Bacteria | 19739 |
| 210 | Ga0466716_447777 | 3300042605 | Bacteria | 8627 |
| 211 | Ga0466722_191859 | 3300042609 | Bacteria | 8459 |
| 212 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 213 | Ga0123357_10058045 | 3300009784 | Bacteria | 5198 |
| 214 | Ga0123357_10184351 | 3300009784 | Bacteria | 2426 |
| 215 | Ga0466705_148453 | 3300042612 | Bacteria | 17997 |
| 216 | Ga0466705_148962 | 3300042612 | Bacteria | 12144 |
| 217 | Ga0466705_166166 | 3300042612 | Unclassified | 5971 |
| 218 | Ga0466732_454516 | 3300042656 | Bacteria | 9336 |
| 219 | IMNBL1DRAFT_c0000105 | 3300000062 | Bacteria | 74361 |
| 220 | IMNBL1DRAFT_c0004985 | 3300000062 | Bacteria | 7748 |
| 221 | Ga0123357_10002245 | 3300009784 | Bacteria | 21372 |
| 222 | Ga0466657_328550 | 3300042582 | Bacteria | 7009 |
| 223 | Ga0466690_320964 | 3300042590 | Bacteria | 3290 |
| 224 | Ga0466692_106439 | 3300042591 | Bacteria | 7904 |
| 225 | Ga0466691_193235 | 3300042593 | Bacteria | 19368 |
| 226 | Ga0466694_089106 | 3300042594 | Bacteria | 5164 |
| 227 | Ga0466696_032004 | 3300042596 | Bacteria | 17335 |
| 228 | Ga0466696_138877 | 3300042596 | Bacteria | 4069 |
| 229 | Ga0466696_288691 | 3300042596 | Bacteria | 66943 |
| 230 | Ga0466715_548439 | 3300042616 | Bacteria | 4680 |
| 231 | Ga0466726_347800 | 3300042619 | Bacteria | 6875 |
| 232 | Ga0466729_085738 | 3300042621 | Bacteria | 7320 |
| 233 | Ga0466735_133614 | 3300042624 | Bacteria | 4100 |
| 234 | Ga0466735_234440 | 3300042624 | Bacteria | 6739 |
| 235 | Ga0466703_012871 | 3300042636 | Bacteria | 30811 |
| 236 | Ga0466704_028552 | 3300042643 | Bacteria | 10407 |
| 237 | Ga0466704_084429 | 3300042643 | Bacteria | 3253 |
| 238 | Ga0466704_318988 | 3300042643 | Bacteria | 22403 |
| 239 | Ga0466704_457121 | 3300042643 | Bacteria | 2896 |
| 240 | Ga0466709_211417 | 3300042648 | Bacteria | 11116 |
| 241 | Ga0466708_043885 | 3300042652 | Bacteria | 10654 |
| 242 | Ga0466708_436613 | 3300042652 | Bacteria | 23189 |
| 243 | Ga0466725_459334 | 3300042654 | Bacteria | 6288 |
| 244 | Ga0466727_109648 | 3300042655 | Bacteria | 7974 |
| 245 | Ga0466706_246860 | 3300042599 | Bacteria | 13299 |
| 246 | Ga0466707_038370 | 3300042601 | Bacteria | 4211 |
| 247 | Ga0466707_058779 | 3300042601 | Bacteria | 10279 |
| 248 | Ga0466707_396605 | 3300042601 | Bacteria | 5023 |
| 249 | Ga0466713_136156 | 3300042602 | Bacteria | 13600 |
| 250 | Ga0466714_028916 | 3300042603 | Bacteria | 17372 |
| 251 | Ga0466716_098245 | 3300042605 | Bacteria | 7899 |
| 252 | Ga0466719_151477 | 3300042606 | Bacteria | 4577 |
| 253 | Ga0466719_370020 | 3300042606 | Bacteria | 7988 |
| 254 | Ga0466719_479329 | 3300042606 | Bacteria | 10090 |
| 255 | Ga0466722_053691 | 3300042609 | Bacteria | 10475 |
| 256 | Ga0466722_068904 | 3300042609 | Bacteria | 7572 |
| 257 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 258 | IMNBL1DRAFT_c0007582 | 3300000062 | Bacteria | 5678 |
| 259 | IMNBL1DRAFT_c0007977 | 3300000062 | Bacteria | 5465 |
| 260 | Ga0123357_10001938 | 3300009784 | Bacteria | 22559 |
| 261 | Ga0466690_034122 | 3300042590 | Bacteria | 27728 |
| 262 | Ga0466690_141982 | 3300042590 | Bacteria | 5169 |
| 263 | Ga0466690_185946 | 3300042590 | Bacteria | 26397 |
| 264 | Ga0466690_215177 | 3300042590 | Bacteria | 14763 |
| 265 | Ga0466690_356294 | 3300042590 | Bacteria | 4651 |
| 266 | Ga0466690_381659 | 3300042590 | Bacteria | 17744 |
| 267 | Ga0466691_115264 | 3300042593 | Bacteria | 13924 |
| 268 | Ga0466696_165931 | 3300042596 | Bacteria | 13709 |
| 269 | Ga0466705_466589 | 3300042612 | Bacteria | 7319 |
| 270 | Ga0466723_028498 | 3300042618 | Bacteria | 28867 |
| 271 | Ga0466728_404970 | 3300042620 | Bacteria | 46041 |
| 272 | Ga0466703_239755 | 3300042636 | Bacteria | 22414 |
| 273 | Ga0466704_276921 | 3300042643 | Bacteria | 3224 |
| 274 | Ga0466707_030009 | 3300042601 | Bacteria | 7069 |
| 275 | Ga0466707_044398 | 3300042601 | Bacteria | 37204 |
| 276 | Ga0466707_306548 | 3300042601 | Bacteria | 12178 |
| 277 | Ga0466713_077495 | 3300042602 | Bacteria | 42226 |
| 278 | Ga0466714_025158 | 3300042603 | Bacteria | 61228 |
| 279 | Ga0466719_195084 | 3300042606 | Bacteria | 2444 |
| 280 | Ga0466719_335843 | 3300042606 | Bacteria | 6365 |
| 281 | Ga0466722_085003 | 3300042609 | Bacteria | 2980 |
| 282 | Ga0466722_204658 | 3300042609 | Bacteria | 3573 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF22042 | EF-G_D2 | Elongation factor G domain 2 | 335 | 420 | 0.98 |
| PF16658 | RF3_C | Class II release factor RF3, C-terminal domain | 426 | 553 | 0.97 |
| PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 354 | 419 | 0.94 |
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 28 | 317 | 0.92 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 32 | 159 | 0.78 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03144 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.