Protein Family IF04634
Metagenome
Isolate
113
Members
40
Samples
108
Scaffolds
305.47
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_049268|Ga0466692_049268_405_1436
- Length
- 343 aa
- Sequence
- MSKRQKALAAIIACALFWGFSFISIKITIAVFPPMSLGMLRFAMALVFLYAIKRKLAPHEKLRLKDVPLLFGAGLTGVTLYFFCENNGVSLVTASEASIAIGSIPVLTMITDWLFGKFARTATRRAAISGGGASTPQAVAPMDAEALPTNSARALALKRAATEQRIRVSQWAGSLISIAGVWLVAGVSLTLSGSVLGYIYMAGAALSWVAYSFLTRPLFSRCSRIHIVFWQSVAGFICFIPFSVFELSRWASPSLPVLLHLAFLGVCCSALGYWLYAHALEVLGVSVCATFINLIPVITVIAGFFIMGDRLAPLQWLGAALVIGGVYLAMREEKKPVQNNGYL
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Kalotermitidae
34.2%
Unclassified
13.2%
Rhinotermitidae
7.9%
Termopsidae
5.3%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 22 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_156388 | 3300042656 | Bacteria | 7395 |
| 2 | Ga0466712_043524 | 3300042614 | Bacteria | 1992 |
| 3 | Ga0466712_177206 | 3300042614 | Bacteria | 1427 |
| 4 | Ga0466723_019600 | 3300042618 | Bacteria | 13548 |
| 5 | Ga0466694_148087 | 3300042594 | Bacteria | 4869 |
| 6 | Ga0466699_206722 | 3300042597 | Unclassified | 2767 |
| 7 | Ga0466699_365852 | 3300042597 | Bacteria | 3865 |
| 8 | Ga0123353_10197361 | 3300010167 | Bacteria | 3171 |
| 9 | JGI24698J34947_10006858 | 3300002449 | Unclassified | 6259 |
| 10 | JGI24698J34947_10008972 | 3300002449 | Bacteria | 5482 |
| 11 | JGI24698J34947_10081465 | 3300002449 | Bacteria | 1517 |
| 12 | Ga0466701_065684 | 3300042598 | Bacteria | 3198 |
| 13 | Ga0466719_192902 | 3300042606 | Bacteria | 2705 |
| 14 | Ga0466720_184369 | 3300042607 | Bacteria | 11074 |
| 15 | Ga0466722_076305 | 3300042609 | Bacteria | 5603 |
| 16 | Ga0466733_066696 | 3300042659 | Bacteria | 2566 |
| 17 | Ga0466733_086185 | 3300042659 | Bacteria | 1731 |
| 18 | Ga0466728_373465 | 3300042620 | Bacteria | 5242 |
| 19 | Ga0466691_058612 | 3300042593 | Bacteria | 167737 |
| 20 | Ga0466694_276013 | 3300042594 | Bacteria | 1265 |
| 21 | Ga0466699_108293 | 3300042597 | Bacteria | 8940 |
| 22 | Ga0466699_256325 | 3300042597 | Bacteria | 1786 |
| 23 | Ga0123353_10452775 | 3300010167 | Bacteria | 1889 |
| 24 | Ga0123354_10050291 | 3300010882 | Bacteria | 6311 |
| 25 | Ga0466706_281929 | 3300042599 | Bacteria | 2387 |
| 26 | Ga0466717_263320 | 3300042604 | Bacteria | 1191 |
| 27 | Ga0466722_069838 | 3300042609 | Bacteria | 18339 |
| 28 | Ga0466733_057669 | 3300042659 | Bacteria | 21807 |
| 29 | Ga0466733_107003 | 3300042659 | Bacteria | 7476 |
| 30 | Ga0466712_198164 | 3300042614 | Bacteria | 2649 |
| 31 | Ga0466723_031884 | 3300042618 | Bacteria | 9442 |
| 32 | Ga0466726_082970 | 3300042619 | Bacteria | 2095 |
| 33 | Ga0466694_343165 | 3300042594 | Bacteria | 2750 |
| 34 | Ga0123356_10168502 | 3300010049 | Bacteria | 2198 |
| 35 | JGI24698J34947_10077587 | 3300002449 | Bacteria | 1570 |
| 36 | Ga0466706_244885 | 3300042599 | Bacteria | 8199 |
| 37 | Ga0466705_249916 | 3300042612 | Bacteria | 7236 |
| 38 | Ga0466712_001869 | 3300042614 | Bacteria | 11744 |
| 39 | Ga0466712_038334 | 3300042614 | Bacteria | 4923 |
| 40 | Ga0466712_250015 | 3300042614 | Bacteria | 4097 |
| 41 | Ga0466728_315217 | 3300042620 | Bacteria | 11977 |
| 42 | Ga0466690_329663 | 3300042590 | Bacteria | 25608 |
| 43 | Ga0466699_105969 | 3300042597 | Bacteria | 1051 |
| 44 | JGI24698J34947_10008670 | 3300002449 | Bacteria | 5579 |
| 45 | JGI24698J34947_10062828 | 3300002449 | Bacteria | 1822 |
| 46 | Ga0466706_218594 | 3300042599 | Bacteria | 1088 |
| 47 | Ga0466715_220066 | 3300042616 | Bacteria | 6226 |
| 48 | Ga0466718_108118 | 3300042617 | Bacteria | 2180 |
| 49 | Ga0466718_168204 | 3300042617 | Bacteria | 2508 |
| 50 | Ga0466723_064777 | 3300042618 | Bacteria | 1490 |
| 51 | Ga0466704_161605 | 3300042643 | Bacteria | 72612 |
| 52 | Ga0466708_293099 | 3300042652 | Bacteria | 12356 |
| 53 | Ga0466692_178039 | 3300042591 | Bacteria | 6909 |
| 54 | Ga0466691_068932 | 3300042593 | Bacteria | 15170 |
| 55 | Ga0466691_202771 | 3300042593 | Bacteria | 16700 |
| 56 | Ga0466699_231649 | 3300042597 | Bacteria | 1695 |
| 57 | Ga0123356_10033454 | 3300010049 | Bacteria | 4806 |
| 58 | JGI24698J34947_10075207 | 3300002449 | Unclassified | 1607 |
| 59 | Ga0072941_1008810 | 3300005201 | Bacteria | 20718 |
| 60 | Ga0466716_106786 | 3300042605 | Bacteria | 35327 |
| 61 | Ga0466716_543261 | 3300042605 | Bacteria | 2641 |
| 62 | Ga0466720_059521 | 3300042607 | Bacteria | 1095 |
| 63 | Ga0466722_057113 | 3300042609 | Bacteria | 3755 |
| 64 | Ga0466722_120344 | 3300042609 | Bacteria | 12092 |
| 65 | Ga0466732_181547 | 3300042656 | Bacteria | 2746 |
| 66 | Ga0466733_104273 | 3300042659 | Bacteria | 3478 |
| 67 | Ga0466712_077817 | 3300042614 | Bacteria | 1777 |
| 68 | Ga0466711_416075 | 3300042615 | Bacteria | 1240 |
| 69 | Ga0466715_058114 | 3300042616 | Bacteria | 12665 |
| 70 | Ga0466723_079390 | 3300042618 | Bacteria | 5113 |
| 71 | Ga0466708_154773 | 3300042652 | Bacteria | 8497 |
| 72 | Ga0466727_057044 | 3300042655 | Unclassified | 1543 |
| 73 | Ga0456237_0000238 | 3300041968 | Bacteria | 8011 |
| 74 | Ga0466690_303422 | 3300042590 | Bacteria | 5165 |
| 75 | Ga0466692_017567 | 3300042591 | Bacteria | 1086 |
| 76 | Ga0466692_049268 | 3300042591 | Bacteria | 2079 |
| 77 | Ga0466692_106188 | 3300042591 | Bacteria | 1580 |
| 78 | Ga0466694_030211 | 3300042594 | Bacteria | 1092 |
| 79 | Ga0466696_461607 | 3300042596 | Bacteria | 4779 |
| 80 | Ga0466699_009353 | 3300042597 | Bacteria | 1466 |
| 81 | JGI24698J34947_10009318 | 3300002449 | Bacteria | 5391 |
| 82 | Ga0072941_1028500 | 3300005201 | Bacteria | 4807 |
| 83 | Ga0072941_1122394 | 3300005201 | Bacteria | 2662 |
| 84 | Ga0466712_043468 | 3300042614 | Bacteria | 3991 |
| 85 | Ga0466712_111011 | 3300042614 | Bacteria | 6630 |
| 86 | Ga0466712_173259 | 3300042614 | Bacteria | 1301 |
| 87 | Ga0466712_291973 | 3300042614 | Bacteria | 2708 |
| 88 | Ga0466715_120916 | 3300042616 | Bacteria | 40906 |
| 89 | Ga0466715_490102 | 3300042616 | Bacteria | 1712 |
| 90 | Ga0466703_124592 | 3300042636 | Bacteria | 15584 |
| 91 | Ga0466704_193781 | 3300042643 | Bacteria | 37721 |
| 92 | Ga0466691_091199 | 3300042593 | Bacteria | 2617 |
| 93 | Ga0466696_353408 | 3300042596 | Bacteria | 5098 |
| 94 | Ga0466699_402806 | 3300042597 | Bacteria | 2271 |
| 95 | JGI24698J34947_10002891 | 3300002449 | Bacteria | 9311 |
| 96 | Ga0466716_049143 | 3300042605 | Bacteria | 3910 |
| 97 | Ga0466720_156820 | 3300042607 | Bacteria | 42318 |
| 98 | Ga0466705_065638 | 3300042612 | Bacteria | 4362 |
| 99 | Ga0466705_347130 | 3300042612 | Bacteria | 7445 |
| 100 | Ga0466733_120926 | 3300042659 | Bacteria | 29363 |
| 101 | Ga0466715_495777 | 3300042616 | Bacteria | 11501 |
| 102 | Ga0466703_363708 | 3300042636 | Bacteria | 18578 |
| 103 | Ga0264413_100615 | 3300024493 | Bacteria | 67644 |
| 104 | Ga0466699_316276 | 3300042597 | Bacteria | 1289 |
| 105 | Ga0123353_10098654 | 3300010167 | Bacteria | 4708 |
| 106 | AustNasuHG_c1002252 | 3300000089 | Bacteria | 6957 |
| 107 | JGI24698J34947_10016610 | 3300002449 | Bacteria | 3993 |
| 108 | Ga0466722_120064 | 3300042609 | Bacteria | 13407 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00892 | EamA | EamA-like transporter family | 196 | 330 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00892 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.