Protein Family IF04614
Metagenome
Isolate
249
Members
54
Samples
243
Scaffolds
186.54
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_028086|Ga0466692_028086_190_837
- Length
- 215 aa
- Sequence
- MLLFWFLSVVILFTSCYYKIIKAFDAMFRYCPACASQNIVFRDGKSFRCPDCGFVYYHNIAAATGCVIRIPDAVSTNKNGERLVFLVRGKEPAIGKLDLPGGFVDLHEGALEGLYRELKEEIGWTPPLSEGVSLADVFTLFASFPNVYPYKGIIYNTCDLFFSLTAPGLTEQDLSLEEAEIAGVRLLRPNEINFDDFAFDSTKWAVKAYLELRGR
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Kalotermitidae
27.5%
Unclassified
13.7%
Rhinotermitidae
7.8%
Termopsidae
2.0%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 27 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 45 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 46 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 47 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 48 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 49 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_067181 | 3300042612 | Bacteria | 19430 |
| 2 | Ga0415639_046599 | 3300038395 | Bacteria | 7247 |
| 3 | Ga0466691_006087 | 3300042593 | Bacteria | 1537 |
| 4 | Ga0466694_175071 | 3300042594 | Bacteria | 2503 |
| 5 | Ga0466695_316094 | 3300042595 | Bacteria | 79149 |
| 6 | JGI24698J34947_10000815 | 3300002449 | Unclassified | 15534 |
| 7 | JGI24698J34947_10031103 | 3300002449 | Bacteria | 2812 |
| 8 | JGI24698J34947_10034154 | 3300002449 | Bacteria | 2664 |
| 9 | JGI24698J34947_10092964 | 3300002449 | Bacteria | 1378 |
| 10 | JGI24698J34947_10150684 | 3300002449 | Bacteria | 966 |
| 11 | Ga0072940_1042836 | 3300005200 | Bacteria | 1993 |
| 12 | Ga0072940_1068304 | 3300005200 | Bacteria | 3446 |
| 13 | Ga0072941_1018050 | 3300005201 | Bacteria | 5271 |
| 14 | Ga0072941_1026604 | 3300005201 | Unclassified | 4163 |
| 15 | Ga0074263_101471 | 3300005485 | Unclassified | 2060 |
| 16 | Ga0074263_118108 | 3300005485 | Bacteria | 5130 |
| 17 | Ga0466703_215636 | 3300042636 | Bacteria | 2793 |
| 18 | Ga0466720_175823 | 3300042607 | Bacteria | 1918 |
| 19 | Ga0466722_038873 | 3300042609 | Bacteria | 2493 |
| 20 | Ga0466722_210997 | 3300042609 | Bacteria | 1085 |
| 21 | Ga0466698_092876 | 3300042610 | Bacteria | 3391 |
| 22 | Ga0466712_064359 | 3300042614 | Bacteria | 30896 |
| 23 | Ga0466712_180656 | 3300042614 | Bacteria | 2124 |
| 24 | Ga0466712_242298 | 3300042614 | Bacteria | 5886 |
| 25 | Ga0466712_277368 | 3300042614 | Bacteria | 1017 |
| 26 | Ga0466718_076974 | 3300042617 | Bacteria | 1512 |
| 27 | Ga0466718_117935 | 3300042617 | Bacteria | 1212 |
| 28 | Ga0466718_117998 | 3300042617 | Bacteria | 1150 |
| 29 | Ga0466726_019070 | 3300042619 | Bacteria | 14285 |
| 30 | Ga0466728_100942 | 3300042620 | Bacteria | 2925 |
| 31 | Ga0466732_172314 | 3300042656 | Bacteria | 3010 |
| 32 | Ga0264413_102978 | 3300024493 | Bacteria | 8322 |
| 33 | Ga0415639_219300 | 3300038395 | Bacteria | 1169 |
| 34 | Ga0456237_0018123 | 3300041968 | Bacteria | 986 |
| 35 | Ga0466692_008064 | 3300042591 | Bacteria | 6143 |
| 36 | Ga0466692_051627 | 3300042591 | Bacteria | 9281 |
| 37 | Ga0466694_231442 | 3300042594 | Bacteria | 3691 |
| 38 | Ga0466696_280445 | 3300042596 | Bacteria | 3730 |
| 39 | Ga0466699_178669 | 3300042597 | Bacteria | 4577 |
| 40 | Ga0466699_181356 | 3300042597 | Bacteria | 4581 |
| 41 | Ga0123353_10499414 | 3300010167 | Bacteria | 1773 |
| 42 | FAAS_10007974 | 3300001880 | Bacteria | 846 |
| 43 | JGI24698J34947_10004046 | 3300002449 | Bacteria | 7964 |
| 44 | JGI24698J34947_10110403 | 3300002449 | Bacteria | 1215 |
| 45 | JGI24698J34947_10200682 | 3300002449 | Bacteria | 781 |
| 46 | JGI24695J34938_10003647 | 3300002450 | Bacteria | 10567 |
| 47 | JGI24695J34938_10006885 | 3300002450 | Bacteria | 6748 |
| 48 | JGI24695J34938_10089929 | 3300002450 | Bacteria | 1260 |
| 49 | Ga0072941_1012053 | 3300005201 | Bacteria | 14304 |
| 50 | Ga0466704_178857 | 3300042643 | Bacteria | 4944 |
| 51 | Ga0466709_312480 | 3300042648 | Bacteria | 2945 |
| 52 | Ga0466717_073327 | 3300042604 | Bacteria | 2513 |
| 53 | Ga0466716_221915 | 3300042605 | Bacteria | 3885 |
| 54 | Ga0466720_092359 | 3300042607 | Bacteria | 3391 |
| 55 | Ga0466712_007240 | 3300042614 | Bacteria | 1857 |
| 56 | Ga0466712_020200 | 3300042614 | Bacteria | 3908 |
| 57 | Ga0466711_254122 | 3300042615 | Bacteria | 3142 |
| 58 | Ga0466715_458996 | 3300042616 | Bacteria | 6415 |
| 59 | Ga0466718_073935 | 3300042617 | Bacteria | 8701 |
| 60 | Ga0466718_119078 | 3300042617 | Bacteria | 2651 |
| 61 | Ga0466718_128736 | 3300042617 | Bacteria | 1120 |
| 62 | Ga0466728_096358 | 3300042620 | Bacteria | 6638 |
| 63 | Ga0466732_298972 | 3300042656 | Bacteria | 8177 |
| 64 | Ga0264413_104793 | 3300024493 | Bacteria | 15581 |
| 65 | Ga0466692_028086 | 3300042591 | Bacteria | 1268 |
| 66 | Ga0466694_159830 | 3300042594 | Bacteria | 1363 |
| 67 | Ga0466694_278488 | 3300042594 | Bacteria | 2504 |
| 68 | Ga0466694_291839 | 3300042594 | Bacteria | 1223 |
| 69 | Ga0466699_183751 | 3300042597 | Bacteria | 6490 |
| 70 | Ga0466699_429253 | 3300042597 | Bacteria | 2856 |
| 71 | Ga0123356_10186376 | 3300010049 | Bacteria | 2102 |
| 72 | AustNasuHG_c1048852 | 3300000089 | Bacteria | 925 |
| 73 | JGI24698J34947_10006433 | 3300002449 | Bacteria | 6447 |
| 74 | JGI24698J34947_10037244 | 3300002449 | Bacteria | 2528 |
| 75 | JGI24698J34947_10066957 | 3300002449 | Bacteria | 1745 |
| 76 | JGI24696J40584_12955431 | 3300002834 | Bacteria | 2832 |
| 77 | Ga0072941_1029193 | 3300005201 | Bacteria | 2534 |
| 78 | Ga0072941_1075409 | 3300005201 | Bacteria | 3497 |
| 79 | Ga0466700_017887 | 3300042600 | Bacteria | 21698 |
| 80 | Ga0466719_042821 | 3300042606 | Bacteria | 7592 |
| 81 | Ga0466720_024533 | 3300042607 | Bacteria | 4623 |
| 82 | Ga0466720_044740 | 3300042607 | Bacteria | 14215 |
| 83 | Ga0466698_217611 | 3300042610 | Bacteria | 3626 |
| 84 | Ga0466698_352812 | 3300042610 | Bacteria | 1221 |
| 85 | Ga0466712_059856 | 3300042614 | Bacteria | 35187 |
| 86 | Ga0466711_310488 | 3300042615 | Bacteria | 1134 |
| 87 | Ga0466718_021868 | 3300042617 | Bacteria | 45512 |
| 88 | Ga0466718_095017 | 3300042617 | Bacteria | 6920 |
| 89 | Ga0466723_059913 | 3300042618 | Bacteria | 1783 |
| 90 | Ga0466732_061597 | 3300042656 | Bacteria | 1008 |
| 91 | Ga0264413_107635 | 3300024493 | Bacteria | 5282 |
| 92 | Ga0415639_080847 | 3300038395 | Bacteria | 4197 |
| 93 | Ga0466690_351865 | 3300042590 | Bacteria | 3875 |
| 94 | Ga0466692_026800 | 3300042591 | Bacteria | 1186 |
| 95 | Ga0466694_070100 | 3300042594 | Bacteria | 21972 |
| 96 | Ga0466694_247980 | 3300042594 | Bacteria | 1177 |
| 97 | Ga0466699_018053 | 3300042597 | Bacteria | 1197 |
| 98 | Ga0123353_10141773 | 3300010167 | Bacteria | 3848 |
| 99 | AustNasuHG_c1001014 | 3300000089 | Bacteria | 10131 |
| 100 | AustNasuHG_c1040101 | 3300000089 | Unclassified | 1151 |
| 101 | AustNasuHG_c1063632 | 3300000089 | Bacteria | 699 |
| 102 | JGI24698J34947_10004973 | 3300002449 | Bacteria | 7284 |
| 103 | JGI24698J34947_10017358 | 3300002449 | Bacteria | 3900 |
| 104 | JGI24698J34947_10037860 | 3300002449 | Bacteria | 2504 |
| 105 | Ga0072940_1026970 | 3300005200 | Bacteria | 3395 |
| 106 | Ga0072940_1066603 | 3300005200 | Bacteria | 1591 |
| 107 | Ga0466731_405101 | 3300042622 | Bacteria | 4215 |
| 108 | Ga0466702_277608 | 3300042635 | Bacteria | 17818 |
| 109 | Ga0466703_205334 | 3300042636 | Bacteria | 1238 |
| 110 | Ga0466724_67691 | 3300042649 | Bacteria | 1035 |
| 111 | Ga0466708_077152 | 3300042652 | Bacteria | 14695 |
| 112 | Ga0466719_334169 | 3300042606 | Bacteria | 3010 |
| 113 | Ga0466722_030188 | 3300042609 | Bacteria | 2146 |
| 114 | Ga0466698_371676 | 3300042610 | Bacteria | 1511 |
| 115 | Ga0466712_038353 | 3300042614 | Bacteria | 13126 |
| 116 | Ga0466712_044003 | 3300042614 | Bacteria | 1286 |
| 117 | Ga0466712_045049 | 3300042614 | Bacteria | 38257 |
| 118 | Ga0466712_059080 | 3300042614 | Bacteria | 44737 |
| 119 | Ga0466712_091709 | 3300042614 | Bacteria | 2679 |
| 120 | Ga0466712_206744 | 3300042614 | Bacteria | 4863 |
| 121 | Ga0466712_221213 | 3300042614 | Bacteria | 6373 |
| 122 | Ga0466718_073383 | 3300042617 | Bacteria | 3837 |
| 123 | Ga0466732_040668 | 3300042656 | Bacteria | 6508 |
| 124 | Ga0466732_278453 | 3300042656 | Unclassified | 2250 |
| 125 | Ga0264413_126989 | 3300024493 | Bacteria | 3348 |
| 126 | Ga0415639_085036 | 3300038395 | Bacteria | 2177 |
| 127 | Ga0466694_065460 | 3300042594 | Bacteria | 4335 |
| 128 | Ga0466699_106366 | 3300042597 | Bacteria | 1985 |
| 129 | Ga0123356_10000619 | 3300010049 | Bacteria | 39296 |
| 130 | Ga0123356_10379942 | 3300010049 | Bacteria | 1545 |
| 131 | Ga0123353_10166554 | 3300010167 | Bacteria | 3502 |
| 132 | AustNasuHG_c1000931 | 3300000089 | Bacteria | 10577 |
| 133 | JGI24698J34947_10030523 | 3300002449 | Bacteria | 2842 |
| 134 | JGI24698J34947_10073596 | 3300002449 | Bacteria | 1630 |
| 135 | JGI24698J34947_10075228 | 3300002449 | Bacteria | 1606 |
| 136 | JGI24698J34947_10086571 | 3300002449 | Bacteria | 1451 |
| 137 | JGI24695J34938_10003674 | 3300002450 | Bacteria | 10507 |
| 138 | JGI24700J35501_10930915 | 3300002508 | Bacteria | 43325 |
| 139 | Ga0072940_1024925 | 3300005200 | Bacteria | 10764 |
| 140 | Ga0072940_1096004 | 3300005200 | Bacteria | 1379 |
| 141 | Ga0072941_1038704 | 3300005201 | Bacteria | 9416 |
| 142 | Ga0074263_130257 | 3300005485 | Bacteria | 890 |
| 143 | Ga0466731_027785 | 3300042622 | Bacteria | 46356 |
| 144 | Ga0466702_239790 | 3300042635 | Bacteria | 1264 |
| 145 | Ga0466720_009009 | 3300042607 | Bacteria | 4024 |
| 146 | Ga0466720_080603 | 3300042607 | Unclassified | 2272 |
| 147 | Ga0466722_116942 | 3300042609 | Bacteria | 20186 |
| 148 | Ga0466722_128753 | 3300042609 | Bacteria | 10433 |
| 149 | Ga0466722_194523 | 3300042609 | Bacteria | 2748 |
| 150 | Ga0466712_005026 | 3300042614 | Bacteria | 10450 |
| 151 | Ga0466712_027439 | 3300042614 | Bacteria | 6073 |
| 152 | Ga0466712_274011 | 3300042614 | Bacteria | 3948 |
| 153 | Ga0466712_310634 | 3300042614 | Bacteria | 1299 |
| 154 | Ga0466712_313429 | 3300042614 | Bacteria | 1316 |
| 155 | Ga0466718_014974 | 3300042617 | Bacteria | 1863 |
| 156 | Ga0466718_040210 | 3300042617 | Bacteria | 4203 |
| 157 | Ga0466718_046089 | 3300042617 | Unclassified | 2237 |
| 158 | Ga0466718_057113 | 3300042617 | Bacteria | 1845 |
| 159 | Ga0466718_077173 | 3300042617 | Bacteria | 5323 |
| 160 | Ga0466718_137217 | 3300042617 | Bacteria | 3160 |
| 161 | Ga0466718_143526 | 3300042617 | Bacteria | 5157 |
| 162 | Ga0466723_050342 | 3300042618 | Bacteria | 7098 |
| 163 | Ga0264413_102909 | 3300024493 | Bacteria | 23920 |
| 164 | Ga0466690_115078 | 3300042590 | Unclassified | 1378 |
| 165 | Ga0466699_005184 | 3300042597 | Bacteria | 2565 |
| 166 | Ga0466699_119543 | 3300042597 | Bacteria | 6649 |
| 167 | Ga0466699_221835 | 3300042597 | Bacteria | 2220 |
| 168 | Ga0123356_10667046 | 3300010049 | Bacteria | 1208 |
| 169 | Ga0123353_10058143 | 3300010167 | Bacteria | 6195 |
| 170 | AustNasuHG_c1064641 | 3300000089 | Unclassified | 689 |
| 171 | JGI24698J34947_10041820 | 3300002449 | Bacteria | 2358 |
| 172 | JGI24698J34947_10224276 | 3300002449 | Bacteria | 719 |
| 173 | Ga0072941_1006673 | 3300005201 | Bacteria | 2165 |
| 174 | Ga0072941_1009452 | 3300005201 | Bacteria | 18583 |
| 175 | Ga0074263_110175 | 3300005485 | Bacteria | 1617 |
| 176 | Ga0074263_113474 | 3300005485 | Bacteria | 3533 |
| 177 | Ga0466729_265232 | 3300042621 | Bacteria | 1099 |
| 178 | Ga0466731_092109 | 3300042622 | Bacteria | 1007 |
| 179 | Ga0466702_349296 | 3300042635 | Bacteria | 1269 |
| 180 | Ga0466717_160837 | 3300042604 | Bacteria | 1378 |
| 181 | Ga0466722_126458 | 3300042609 | Bacteria | 1837 |
| 182 | Ga0466722_235177 | 3300042609 | Bacteria | 2305 |
| 183 | Ga0466698_246238 | 3300042610 | Bacteria | 2494 |
| 184 | Ga0466712_088954 | 3300042614 | Unclassified | 2135 |
| 185 | Ga0466712_120756 | 3300042614 | Bacteria | 7704 |
| 186 | Ga0466712_133322 | 3300042614 | Bacteria | 4607 |
| 187 | Ga0466718_016749 | 3300042617 | Bacteria | 1167 |
| 188 | Ga0466718_039376 | 3300042617 | Bacteria | 2228 |
| 189 | Ga0264413_102976 | 3300024493 | Bacteria | 3833 |
| 190 | Ga0264413_109020 | 3300024493 | Bacteria | 1896 |
| 191 | Ga0415639_068102 | 3300038395 | Bacteria | 4822 |
| 192 | Ga0466690_223875 | 3300042590 | Bacteria | 2230 |
| 193 | Ga0466693_013786 | 3300042592 | Unclassified | 4538 |
| 194 | Ga0466691_129376 | 3300042593 | Bacteria | 3217 |
| 195 | Ga0466694_020253 | 3300042594 | Bacteria | 1577 |
| 196 | Ga0466694_080398 | 3300042594 | Bacteria | 11142 |
| 197 | Ga0466694_106966 | 3300042594 | Bacteria | 9310 |
| 198 | Ga0466694_150996 | 3300042594 | Bacteria | 4496 |
| 199 | Ga0466696_088432 | 3300042596 | Bacteria | 6505 |
| 200 | Ga0466699_299521 | 3300042597 | Bacteria | 3401 |
| 201 | Ga0123356_10039008 | 3300010049 | Bacteria | 4426 |
| 202 | AustNasuHG_c1021386 | 3300000089 | Bacteria | 2096 |
| 203 | AustNasuHG_c1048473 | 3300000089 | Bacteria | 934 |
| 204 | JGI24698J34947_10011520 | 3300002449 | Unclassified | 4856 |
| 205 | JGI24698J34947_10081932 | 3300002449 | Bacteria | 1510 |
| 206 | JGI24695J34938_10000502 | 3300002450 | Bacteria | 38047 |
| 207 | Ga0466702_312762 | 3300042635 | Bacteria | 10632 |
| 208 | Ga0466722_088715 | 3300042609 | Bacteria | 13293 |
| 209 | Ga0466712_239926 | 3300042614 | Bacteria | 1080 |
| 210 | Ga0466711_021104 | 3300042615 | Bacteria | 2376 |
| 211 | Ga0466711_247241 | 3300042615 | Bacteria | 5115 |
| 212 | Ga0466723_032478 | 3300042618 | Bacteria | 7790 |
| 213 | Ga0466723_061208 | 3300042618 | Bacteria | 3817 |
| 214 | Ga0466726_435917 | 3300042619 | Bacteria | 2753 |
| 215 | Ga0466732_117098 | 3300042656 | Bacteria | 5994 |
| 216 | Ga0466732_189340 | 3300042656 | Bacteria | 4633 |
| 217 | Ga0264413_102977 | 3300024493 | Bacteria | 25558 |
| 218 | Ga0466694_012568 | 3300042594 | Bacteria | 4746 |
| 219 | Ga0466699_259456 | 3300042597 | Bacteria | 2149 |
| 220 | AustNasuHG_c1002024 | 3300000089 | Bacteria | 7301 |
| 221 | JGI24698J34947_10022975 | 3300002449 | Bacteria | 3338 |
| 222 | JGI24698J34947_10029935 | 3300002449 | Unclassified | 2874 |
| 223 | JGI24698J34947_10031509 | 3300002449 | Bacteria | 2790 |
| 224 | JGI24698J34947_10121685 | 3300002449 | Unclassified | 1131 |
| 225 | JGI24695J34938_10000188 | 3300002450 | Bacteria | 57980 |
| 226 | Ga0072940_1024727 | 3300005200 | Bacteria | 1540 |
| 227 | Ga0072941_1019475 | 3300005201 | Bacteria | 3658 |
| 228 | Ga0072941_1050039 | 3300005201 | Bacteria | 1144 |
| 229 | Ga0466702_006569 | 3300042635 | Bacteria | 2244 |
| 230 | Ga0466708_214785 | 3300042652 | Bacteria | 1992 |
| 231 | Ga0466707_035213 | 3300042601 | Bacteria | 1712 |
| 232 | Ga0466714_055812 | 3300042603 | Bacteria | 1705 |
| 233 | Ga0466719_391413 | 3300042606 | Bacteria | 1460 |
| 234 | Ga0466720_028763 | 3300042607 | Bacteria | 3834 |
| 235 | Ga0466722_153721 | 3300042609 | Bacteria | 2971 |
| 236 | Ga0466722_158554 | 3300042609 | Bacteria | 4225 |
| 237 | Ga0466712_004421 | 3300042614 | Bacteria | 1502 |
| 238 | Ga0466711_137921 | 3300042615 | Bacteria | 9334 |
| 239 | Ga0466718_003398 | 3300042617 | Bacteria | 1201 |
| 240 | Ga0466718_019427 | 3300042617 | Bacteria | 2785 |
| 241 | Ga0466718_053839 | 3300042617 | Bacteria | 3356 |
| 242 | Ga0466718_133121 | 3300042617 | Bacteria | 2420 |
| 243 | Ga0466718_143907 | 3300042617 | Unclassified | 1145 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00293 | NUDIX | NUDIX domain | 74 | 200 | 0.75 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.