Protein Family IF04613
Metagenome
Isolate
104
Members
39
Samples
101
Scaffolds
282.96
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_026125|Ga0466692_026125_17102_18043
- Length
- 313 aa
- Sequence
- MKYFILLNIILIFATSKVIIFLIKTMESLENINLKDFLASDLYNKLLLEAGLFVLKLAACILIYIIGRKIIKYINVLFGKLMSSKGFDLSVASFLKSLVNIILTVTLLLSIVNILGINSSSFVALFASIGVALGMALSGTLQNFSGGVMILLFRPYRVGDYIQAQGQEGTVKAIHIFNTALITADNRTVFIPNGGLSSNTIVNYNEQKNRRIEWIVGVDYGTDYDKVKNIITDIIKIEKKILMEPAPFIALKTLNDSSVDIIIRVWVIKEDYWDVYFNMNEQIYKNFAAKGINIPFPQLTVHLADKQSTCEKL
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
30.8%
Unclassified
12.8%
Termopsidae
10.3%
Rhinotermitidae
7.7%
Passalidae
2.6%
Taxonomy
Archaea
0
Bacteria
100
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_163781 | 3300042615 | Bacteria | 3678 |
| 2 | Ga0466715_302955 | 3300042616 | Bacteria | 14273 |
| 3 | Ga0466713_068452 | 3300042602 | Bacteria | 1912 |
| 4 | Ga0466722_055449 | 3300042609 | Bacteria | 2647 |
| 5 | Ga0466735_014847 | 3300042624 | Unclassified | 6715 |
| 6 | Ga0466703_433540 | 3300042636 | Bacteria | 3422 |
| 7 | Ga0466709_160158 | 3300042648 | Bacteria | 22623 |
| 8 | Ga0466708_092027 | 3300042652 | Bacteria | 8157 |
| 9 | Ga0466727_090088 | 3300042655 | Bacteria | 55654 |
| 10 | Ga0123357_10272374 | 3300009784 | Bacteria | 1766 |
| 11 | JGI24696J40584_12956590 | 3300002834 | Bacteria | 3160 |
| 12 | Ga0466711_204856 | 3300042615 | Bacteria | 25095 |
| 13 | Ga0466715_139194 | 3300042616 | Bacteria | 10244 |
| 14 | Ga0466690_162581 | 3300042590 | Bacteria | 34430 |
| 15 | Ga0466696_186685 | 3300042596 | Bacteria | 6294 |
| 16 | Ga0466707_016891 | 3300042601 | Bacteria | 35922 |
| 17 | Ga0466707_079672 | 3300042601 | Bacteria | 29222 |
| 18 | Ga0466697_126172 | 3300042611 | Bacteria | 1323 |
| 19 | Ga0466705_481059 | 3300042612 | Bacteria | 5614 |
| 20 | Ga0466690_071416 | 3300042590 | Bacteria | 9129 |
| 21 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 22 | Ga0466692_136319 | 3300042591 | Bacteria | 5264 |
| 23 | Ga0466700_000852 | 3300042600 | Bacteria | 5725 |
| 24 | Ga0466700_067064 | 3300042600 | Bacteria | 2893 |
| 25 | Ga0466707_419502 | 3300042601 | Bacteria | 3732 |
| 26 | Ga0466722_084805 | 3300042609 | Bacteria | 3185 |
| 27 | Ga0466735_066001 | 3300042624 | Bacteria | 19305 |
| 28 | Ga0466735_122836 | 3300042624 | Bacteria | 4316 |
| 29 | Ga0466703_122191 | 3300042636 | Bacteria | 2513 |
| 30 | Ga0466703_169590 | 3300042636 | Bacteria | 2425 |
| 31 | Ga0466704_615236 | 3300042643 | Bacteria | 6793 |
| 32 | Ga0123357_10241135 | 3300009784 | Bacteria | 1957 |
| 33 | Ga0123354_10175485 | 3300010882 | Bacteria | 2472 |
| 34 | JGI24702J35022_10015028 | 3300002462 | Bacteria | 4265 |
| 35 | JGI24702J35022_10170339 | 3300002462 | Bacteria | 1231 |
| 36 | Ga0466705_316616 | 3300042612 | Bacteria | 4422 |
| 37 | Ga0466723_087397 | 3300042618 | Bacteria | 8728 |
| 38 | Ga0466723_227802 | 3300042618 | Bacteria | 9019 |
| 39 | Ga0466726_278605 | 3300042619 | Bacteria | 18146 |
| 40 | Ga0466729_165020 | 3300042621 | Bacteria | 3235 |
| 41 | Ga0466656_016225 | 3300042550 | Bacteria | 1345 |
| 42 | Ga0466692_026125 | 3300042591 | Bacteria | 30408 |
| 43 | Ga0466691_199211 | 3300042593 | Bacteria | 19849 |
| 44 | Ga0466701_095274 | 3300042598 | Bacteria | 10560 |
| 45 | Ga0466707_135985 | 3300042601 | Bacteria | 9923 |
| 46 | Ga0466698_166234 | 3300042610 | Bacteria | 1832 |
| 47 | Ga0466734_087963 | 3300042623 | Bacteria | 3129 |
| 48 | Ga0466703_104988 | 3300042636 | Bacteria | 39552 |
| 49 | Ga0466709_104590 | 3300042648 | Bacteria | 4015 |
| 50 | Ga0123353_11130355 | 3300010167 | Unclassified | 1036 |
| 51 | Ga0123354_10080714 | 3300010882 | Bacteria | 4601 |
| 52 | Ga0466707_204099 | 3300042601 | Bacteria | 5375 |
| 53 | Ga0466716_516147 | 3300042605 | Bacteria | 8811 |
| 54 | Ga0466703_113593 | 3300042636 | Bacteria | 10196 |
| 55 | Ga0466704_155397 | 3300042643 | Bacteria | 6296 |
| 56 | Ga0123354_10050949 | 3300010882 | Bacteria | 6258 |
| 57 | Ga0123354_10077909 | 3300010882 | Bacteria | 4716 |
| 58 | Ga0466726_478213 | 3300042619 | Bacteria | 1452 |
| 59 | Ga0466656_367227 | 3300042550 | Bacteria | 1011 |
| 60 | Ga0466690_099393 | 3300042590 | Bacteria | 94849 |
| 61 | Ga0466690_143192 | 3300042590 | Bacteria | 2125 |
| 62 | Ga0466691_045742 | 3300042593 | Bacteria | 5945 |
| 63 | Ga0466713_097567 | 3300042602 | Bacteria | 3303 |
| 64 | Ga0466722_075905 | 3300042609 | Bacteria | 17351 |
| 65 | Ga0466704_155616 | 3300042643 | Bacteria | 11209 |
| 66 | Ga0466709_308531 | 3300042648 | Bacteria | 53963 |
| 67 | Ga0123357_10111493 | 3300009784 | Bacteria | 3485 |
| 68 | Ga0123357_10287100 | 3300009784 | Unclassified | 1688 |
| 69 | Ga0123354_10001662 | 3300010882 | Bacteria | 27721 |
| 70 | JGI24699J35502_11133591 | 3300002509 | Bacteria | 12319 |
| 71 | Ga0068302_10129463 | 3300005071 | Unclassified | 1340 |
| 72 | Ga0466715_136291 | 3300042616 | Bacteria | 8831 |
| 73 | Ga0466692_036494 | 3300042591 | Bacteria | 2696 |
| 74 | Ga0466700_101671 | 3300042600 | Bacteria | 13278 |
| 75 | Ga0466719_075902 | 3300042606 | Bacteria | 8360 |
| 76 | Ga0466719_397245 | 3300042606 | Bacteria | 1927 |
| 77 | Ga0466722_102649 | 3300042609 | Bacteria | 1469 |
| 78 | Ga0466735_210656 | 3300042624 | Bacteria | 2430 |
| 79 | Ga0466727_096564 | 3300042655 | Bacteria | 3713 |
| 80 | Ga0123357_10010854 | 3300009784 | Bacteria | 11624 |
| 81 | Ga0123357_10153121 | 3300009784 | Bacteria | 2791 |
| 82 | Ga0123353_11134454 | 3300010167 | Bacteria | 1034 |
| 83 | Ga0123354_10147279 | 3300010882 | Bacteria | 2875 |
| 84 | Ga0123354_10366356 | 3300010882 | Bacteria | 1263 |
| 85 | Ga0466705_299423 | 3300042612 | Bacteria | 5510 |
| 86 | Ga0466711_056379 | 3300042615 | Bacteria | 6053 |
| 87 | Ga0466715_646578 | 3300042616 | Bacteria | 18752 |
| 88 | Ga0466723_013868 | 3300042618 | Bacteria | 21533 |
| 89 | Ga0466728_152095 | 3300042620 | Bacteria | 7801 |
| 90 | Ga0466729_150991 | 3300042621 | Bacteria | 10821 |
| 91 | Ga0466716_253357 | 3300042605 | Bacteria | 2952 |
| 92 | Ga0466716_446855 | 3300042605 | Bacteria | 3844 |
| 93 | Ga0466719_289941 | 3300042606 | Bacteria | 8721 |
| 94 | Ga0466735_182909 | 3300042624 | Bacteria | 1668 |
| 95 | Ga0466703_241389 | 3300042636 | Bacteria | 1973 |
| 96 | Ga0123357_10086182 | 3300009784 | Bacteria | 4110 |
| 97 | Ga0123353_10452410 | 3300010167 | Bacteria | 1890 |
| 98 | Ga0123354_10070016 | 3300010882 | Bacteria | 5079 |
| 99 | IMNBL1DRAFT_c0012415 | 3300000062 | Bacteria | 3895 |
| 100 | JGI24702J35022_10053164 | 3300002462 | Bacteria | 2160 |
| 101 | JGI24699J35502_11134117 | 3300002509 | Bacteria | 33021 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.