Protein Family IF04608
Metagenome
Isolate
109
Members
45
Samples
103
Scaffolds
394.56
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_017852|Ga0466692_017852_1898_3202
- Length
- 434 aa
- Sequence
- MGGGLARILLKDNGESIFTLPSIPVIIVYYYVRWRIAMQFRIDKKSGHKLSVLGFGCMRFPKNLGAIDMQKTESLIMDAIHGGVNYFDTAYMYPGSEEALGTILEKNKVREWVFVATKLPLVLVRGPEDFDRFFNKQLERLRTGYIDYYLMHMLTDMHLWEKLKDWGIEAWIKEKKQAEQIKQVGFSFHGSQPEFLKLLEAYPWEFCQIQYNYSGENFQAGIVGLKKAAERMSVMVMEPLLGGKLATGLPSEAVAIFKQANPALSPAAWALKWVWNHPEVTLLLSGMNHKRQLEENLDMAGKSASSMLTDEERETYRQVLNVFNAAYKIRCTGCNYCMPCPQHVNIPSCFAAYNTSFSIGFVSGMQQYLTSTGMTSEQTSSPRLCVKCGKCEDHCPQHLPIIKSLEAVRKRMEPFWFRGFIIIARRFLGRNKKK
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.8%
Termitidae
31.8%
Unclassified
15.9%
Rhinotermitidae
9.1%
Termopsidae
6.8%
Passalidae
4.5%
Taxonomy
Archaea
0
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 40 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 41 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_318255 | 3300042592 | Bacteria | 3682 |
| 2 | Ga0466705_516939 | 3300042612 | Bacteria | 3612 |
| 3 | Ga0466712_082997 | 3300042614 | Unclassified | 2378 |
| 4 | Ga0466712_173060 | 3300042614 | Bacteria | 15755 |
| 5 | Ga0466711_253005 | 3300042615 | Bacteria | 37030 |
| 6 | Ga0466715_188740 | 3300042616 | Bacteria | 3690 |
| 7 | Ga0466726_144949 | 3300042619 | Bacteria | 6272 |
| 8 | Ga0466726_198321 | 3300042619 | Bacteria | 3802 |
| 9 | Ga0466728_177705 | 3300042620 | Bacteria | 1703 |
| 10 | Ga0466722_087702 | 3300042609 | Bacteria | 4922 |
| 11 | JGI24702J35022_10010462 | 3300002462 | Bacteria | 5180 |
| 12 | JGI24702J35022_10019626 | 3300002462 | Bacteria | 3676 |
| 13 | JGI24702J35022_10036081 | 3300002462 | Bacteria | 2642 |
| 14 | Ga0456237_0001557 | 3300041968 | Bacteria | 3657 |
| 15 | Ga0466705_186885 | 3300042612 | Bacteria | 2486 |
| 16 | Ga0466715_118971 | 3300042616 | Bacteria | 1965 |
| 17 | Ga0466722_149477 | 3300042609 | Bacteria | 21582 |
| 18 | JGI24698J34947_10006352 | 3300002449 | Bacteria | 6489 |
| 19 | JGI24698J34947_10022727 | 3300002449 | Unclassified | 3359 |
| 20 | JGI24702J35022_10005567 | 3300002462 | Bacteria | 7345 |
| 21 | Ga0072941_1080826 | 3300005201 | Bacteria | 4780 |
| 22 | Ga0123356_10031952 | 3300010049 | Bacteria | 4926 |
| 23 | Ga0466729_211305 | 3300042621 | Bacteria | 1658 |
| 24 | Ga0466735_061209 | 3300042624 | Bacteria | 23420 |
| 25 | Ga0466709_191447 | 3300042648 | Bacteria | 8596 |
| 26 | Ga0466708_117508 | 3300042652 | Bacteria | 5369 |
| 27 | Ga0466708_207640 | 3300042652 | Bacteria | 13121 |
| 28 | Ga0466696_183659 | 3300042596 | Bacteria | 3966 |
| 29 | Ga0466701_075339 | 3300042598 | Bacteria | 7128 |
| 30 | Ga0466707_408897 | 3300042601 | Bacteria | 5202 |
| 31 | Ga0466722_029711 | 3300042609 | Bacteria | 6945 |
| 32 | JGI24705J35276_12201344 | 3300002504 | Unclassified | 1616 |
| 33 | Ga0068305_10047570 | 3300005083 | Bacteria | 4782 |
| 34 | Ga0123357_10199394 | 3300009784 | Bacteria | 2282 |
| 35 | Ga0123354_10026089 | 3300010882 | Bacteria | 9215 |
| 36 | Ga0466703_406569 | 3300042636 | Bacteria | 2541 |
| 37 | Ga0466704_094177 | 3300042643 | Bacteria | 1570 |
| 38 | Ga0466708_358748 | 3300042652 | Bacteria | 2496 |
| 39 | Ga0456237_0008902 | 3300041968 | Bacteria | 1505 |
| 40 | Ga0466690_175525 | 3300042590 | Bacteria | 2006 |
| 41 | Ga0466692_017852 | 3300042591 | Bacteria | 4079 |
| 42 | Ga0466696_332909 | 3300042596 | Bacteria | 5998 |
| 43 | Ga0466715_049697 | 3300042616 | Bacteria | 16425 |
| 44 | Ga0466728_121071 | 3300042620 | Bacteria | 10991 |
| 45 | Ga0466728_293289 | 3300042620 | Bacteria | 9191 |
| 46 | Ga0466719_061422 | 3300042606 | Bacteria | 5464 |
| 47 | Ga0466704_138404 | 3300042643 | Bacteria | 5042 |
| 48 | Ga0466704_182260 | 3300042643 | Bacteria | 5563 |
| 49 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 50 | Ga0466709_081184 | 3300042648 | Bacteria | 5984 |
| 51 | Ga0466727_135810 | 3300042655 | Bacteria | 2829 |
| 52 | Ga0466692_132530 | 3300042591 | Bacteria | 37722 |
| 53 | Ga0466711_295976 | 3300042615 | Bacteria | 7904 |
| 54 | Ga0466715_384931 | 3300042616 | Bacteria | 1564 |
| 55 | Ga0466723_048605 | 3300042618 | Bacteria | 5133 |
| 56 | Ga0466726_281879 | 3300042619 | Bacteria | 12324 |
| 57 | Ga0466722_008744 | 3300042609 | Bacteria | 8339 |
| 58 | Ga0466722_080962 | 3300042609 | Bacteria | 1940 |
| 59 | Ga0466722_142869 | 3300042609 | Bacteria | 11235 |
| 60 | 2227100818 | 2225789004 | Bacteria | 1792 |
| 61 | JGI24702J35022_10003830 | 3300002462 | Unclassified | 9025 |
| 62 | Ga0068305_10038632 | 3300005083 | Bacteria | 2824 |
| 63 | Ga0466735_148931 | 3300042624 | Bacteria | 5347 |
| 64 | Ga0466709_024761 | 3300042648 | Bacteria | 1215 |
| 65 | Ga0466691_058466 | 3300042593 | Bacteria | 2519 |
| 66 | Ga0466691_127989 | 3300042593 | Bacteria | 2013 |
| 67 | Ga0466696_212903 | 3300042596 | Bacteria | 2159 |
| 68 | Ga0466696_317290 | 3300042596 | Bacteria | 9825 |
| 69 | Ga0466705_364178 | 3300042612 | Bacteria | 11345 |
| 70 | Ga0466716_301530 | 3300042605 | Bacteria | 2181 |
| 71 | Ga0466719_471859 | 3300042606 | Bacteria | 4941 |
| 72 | IMNBL1DRAFT_c0000015 | 3300000062 | Bacteria | 179817 |
| 73 | Ga0123353_10193358 | 3300010167 | Bacteria | 3209 |
| 74 | Ga0123353_10223472 | 3300010167 | Bacteria | 2942 |
| 75 | Ga0466729_208531 | 3300042621 | Bacteria | 1451 |
| 76 | Ga0466729_293329 | 3300042621 | Bacteria | 1259 |
| 77 | Ga0466708_100209 | 3300042652 | Bacteria | 2103 |
| 78 | Ga0466705_402819 | 3300042612 | Bacteria | 4299 |
| 79 | Ga0466710_010300 | 3300042613 | Bacteria | 5989 |
| 80 | Ga0466712_163367 | 3300042614 | Bacteria | 5458 |
| 81 | Ga0466715_357562 | 3300042616 | Bacteria | 1496 |
| 82 | Ga0466715_440608 | 3300042616 | Bacteria | 4274 |
| 83 | Ga0466700_249929 | 3300042600 | Bacteria | 3729 |
| 84 | JGI24702J35022_10001713 | 3300002462 | Bacteria | 13602 |
| 85 | Ga0123357_10000079 | 3300009784 | Bacteria | 77150 |
| 86 | Ga0466704_051542 | 3300042643 | Bacteria | 13374 |
| 87 | Ga0466704_392058 | 3300042643 | Bacteria | 1529 |
| 88 | Ga0456237_0000757 | 3300041968 | Unclassified | 5007 |
| 89 | Ga0466694_234563 | 3300042594 | Bacteria | 1417 |
| 90 | Ga0466705_019333 | 3300042612 | Unclassified | 12990 |
| 91 | Ga0466712_037568 | 3300042614 | Bacteria | 7893 |
| 92 | Ga0466711_129320 | 3300042615 | Bacteria | 2880 |
| 93 | Ga0466726_002893 | 3300042619 | Bacteria | 6860 |
| 94 | Ga0466728_484083 | 3300042620 | Bacteria | 5063 |
| 95 | Ga0466707_070768 | 3300042601 | Bacteria | 71942 |
| 96 | Ga0466716_542865 | 3300042605 | Bacteria | 13306 |
| 97 | Ga0466719_143126 | 3300042606 | Bacteria | 13009 |
| 98 | 2227166926 | 2225789004 | Bacteria | 8290 |
| 99 | JGI24702J35022_10042901 | 3300002462 | Bacteria | 2408 |
| 100 | Ga0123354_10107532 | 3300010882 | Bacteria | 3714 |
| 101 | Ga0466735_062176 | 3300042624 | Bacteria | 9128 |
| 102 | Ga0466703_209439 | 3300042636 | Bacteria | 17765 |
| 103 | Ga0466704_026331 | 3300042643 | Bacteria | 4734 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.