Protein Family IF04552
Metagenome
Isolate
124
Members
41
Samples
115
Scaffolds
250.82
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_276450|Ga0466690_276450_90_944
- Length
- 284 aa
- Sequence
- MKQSQYLQILKLVKNSLEEYQNWGEDEVYKPPFVSLRAQELLVADKTLREGSLQAVSKLKASAAASLSNIDASKPNFDPFEELRNKVLNCKDCPLGQTRLNAVFGEGSPRAEIMFVGEGPGFEEDHKARPFIGKAGQFLTNLIELAGYSRETVYIANIVKCHPMKDPLDAERRSNDRPPTDEEIAQCSKYLQRQIEIINPRVIVTLGKPSARYFLKTDAPMSAIRGKFQDYNGIKLMPTYHPSYLIRNGCIFGKKDQSPEITKLKKEVWADFKKVVDFLKTGKE
Sample Types
Isolate
7.3%
Metagenome
92.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.1%
Unclassified
29.3%
Termitidae
17.1%
Termopsidae
9.8%
Rhinotermitidae
7.3%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 13 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 14 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 21 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 28 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 34 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_061609 | 3300042612 | Bacteria | 27577 |
| 2 | Ga0466705_180942 | 3300042612 | Bacteria | 6159 |
| 3 | Ga0466707_227955 | 3300042601 | Bacteria | 35249 |
| 4 | Ga0466713_141549 | 3300042602 | Bacteria | 78387 |
| 5 | Ga0466713_149031 | 3300042602 | Bacteria | 8046 |
| 6 | Ga0466714_049715 | 3300042603 | Bacteria | 54062 |
| 7 | Ga0466711_001984 | 3300042615 | Bacteria | 177943 |
| 8 | Ga0466723_296622 | 3300042618 | Bacteria | 3648 |
| 9 | Ga0466728_050538 | 3300042620 | Bacteria | 48589 |
| 10 | Ga0466690_157575 | 3300042590 | Bacteria | 16521 |
| 11 | Ga0466690_175354 | 3300042590 | Bacteria | 5788 |
| 12 | Ga0466691_145925 | 3300042593 | Bacteria | 6248 |
| 13 | Ga0466696_447977 | 3300042596 | Bacteria | 5070 |
| 14 | Ga0123357_10071320 | 3300009784 | Bacteria | 4607 |
| 15 | JGI24702J35022_10000181 | 3300002462 | Bacteria | 33536 |
| 16 | Ga0068305_10001180 | 3300005083 | Bacteria | 75152 |
| 17 | Ga0466705_212098 | 3300042612 | Bacteria | 11653 |
| 18 | Ga0466707_296432 | 3300042601 | Bacteria | 37556 |
| 19 | Ga0466715_037169 | 3300042616 | Bacteria | 28737 |
| 20 | Ga0466726_077065 | 3300042619 | Bacteria | 22372 |
| 21 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 22 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 23 | Ga0466690_373341 | 3300042590 | Bacteria | 47139 |
| 24 | Ga0466696_227214 | 3300042596 | Unclassified | 5339 |
| 25 | Ga0123355_10035755 | 3300009826 | Bacteria | 8074 |
| 26 | Ga0123354_10000175 | 3300010882 | Bacteria | 53253 |
| 27 | Ga0068305_10000892 | 3300005083 | Bacteria | 14289 |
| 28 | Ga0466735_027573 | 3300042624 | Bacteria | 3269 |
| 29 | Ga0466735_038732 | 3300042624 | Bacteria | 2567 |
| 30 | Ga0466735_171027 | 3300042624 | Bacteria | 8685 |
| 31 | Ga0466704_187080 | 3300042643 | Bacteria | 34147 |
| 32 | Ga0466708_128931 | 3300042652 | Bacteria | 5634 |
| 33 | Ga0466727_048575 | 3300042655 | Bacteria | 22131 |
| 34 | Ga0466727_150924 | 3300042655 | Bacteria | 116830 |
| 35 | Ga0466706_020899 | 3300042599 | Bacteria | 6574 |
| 36 | Ga0466719_040158 | 3300042606 | Bacteria | 56642 |
| 37 | Ga0466715_456889 | 3300042616 | Bacteria | 238254 |
| 38 | Ga0123356_10000001 | 3300010049 | Bacteria | 411946 |
| 39 | JGI24705J35276_12238806 | 3300002504 | Bacteria | 109319 |
| 40 | Ga0466735_042806 | 3300042624 | Bacteria | 1358 |
| 41 | Ga0466735_148918 | 3300042624 | Bacteria | 9858 |
| 42 | Ga0466704_141159 | 3300042643 | Bacteria | 6511 |
| 43 | Ga0466704_313576 | 3300042643 | Bacteria | 29323 |
| 44 | Ga0466709_358602 | 3300042648 | Bacteria | 15312 |
| 45 | Ga0466727_022157 | 3300042655 | Bacteria | 5785 |
| 46 | Ga0466727_345152 | 3300042655 | Bacteria | 5707 |
| 47 | Ga0466719_196832 | 3300042606 | Bacteria | 4570 |
| 48 | Ga0466715_138339 | 3300042616 | Bacteria | 2315 |
| 49 | Ga0466723_308402 | 3300042618 | Bacteria | 12438 |
| 50 | Ga0068302_10003328 | 3300005071 | Bacteria | 9937 |
| 51 | Ga0466735_028435 | 3300042624 | Bacteria | 13806 |
| 52 | Ga0466735_083343 | 3300042624 | Bacteria | 1777 |
| 53 | Ga0466735_110574 | 3300042624 | Bacteria | 4138 |
| 54 | Ga0466735_114890 | 3300042624 | Bacteria | 3515 |
| 55 | Ga0466704_030640 | 3300042643 | Bacteria | 30307 |
| 56 | Ga0466713_091719 | 3300042602 | Bacteria | 33782 |
| 57 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 58 | Ga0466719_451241 | 3300042606 | Bacteria | 1228 |
| 59 | Ga0466711_119484 | 3300042615 | Bacteria | 7708 |
| 60 | Ga0466723_292795 | 3300042618 | Bacteria | 14159 |
| 61 | Ga0466728_080276 | 3300042620 | Bacteria | 1843 |
| 62 | Ga0466728_306322 | 3300042620 | Bacteria | 70422 |
| 63 | Ga0466729_120462 | 3300042621 | Bacteria | 3700 |
| 64 | Ga0466729_141782 | 3300042621 | Bacteria | 7532 |
| 65 | Ga0466690_293515 | 3300042590 | Bacteria | 10110 |
| 66 | Ga0466729_226118 | 3300042621 | Bacteria | 3629 |
| 67 | Ga0466703_343060 | 3300042636 | Bacteria | 3783 |
| 68 | Ga0466727_334301 | 3300042655 | Bacteria | 22103 |
| 69 | Ga0466705_321631 | 3300042612 | Bacteria | 270475 |
| 70 | Ga0466707_013650 | 3300042601 | Bacteria | 197174 |
| 71 | Ga0466722_107368 | 3300042609 | Bacteria | 1294 |
| 72 | Ga0466722_139133 | 3300042609 | Bacteria | 9921 |
| 73 | Ga0466711_246643 | 3300042615 | Bacteria | 90615 |
| 74 | Ga0466715_269081 | 3300042616 | Bacteria | 14287 |
| 75 | Ga0466715_485668 | 3300042616 | Bacteria | 1811 |
| 76 | Ga0466726_093745 | 3300042619 | Bacteria | 52716 |
| 77 | Ga0466690_276450 | 3300042590 | Bacteria | 2408 |
| 78 | Ga0466691_136697 | 3300042593 | Bacteria | 59104 |
| 79 | Ga0068305_10000893 | 3300005083 | Unclassified | 27690 |
| 80 | Ga0466735_052431 | 3300042624 | Bacteria | 6813 |
| 81 | Ga0466704_485651 | 3300042643 | Unclassified | 4545 |
| 82 | Ga0466706_006636 | 3300042599 | Bacteria | 217881 |
| 83 | Ga0466706_222182 | 3300042599 | Bacteria | 2272 |
| 84 | Ga0466706_278099 | 3300042599 | Bacteria | 22231 |
| 85 | Ga0466716_426110 | 3300042605 | Bacteria | 2855 |
| 86 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 87 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 88 | Ga0466715_141325 | 3300042616 | Bacteria | 38841 |
| 89 | Ga0466723_141698 | 3300042618 | Bacteria | 266684 |
| 90 | Ga0466726_438120 | 3300042619 | Bacteria | 4581 |
| 91 | Ga0466729_033387 | 3300042621 | Bacteria | 7026 |
| 92 | Ga0466729_119088 | 3300042621 | Bacteria | 27516 |
| 93 | Ga0466690_088220 | 3300042590 | Bacteria | 1018 |
| 94 | Ga0466690_269035 | 3300042590 | Bacteria | 23958 |
| 95 | Ga0068305_10000184 | 3300005083 | Bacteria | 99663 |
| 96 | Ga0068305_10001288 | 3300005083 | Bacteria | 15319 |
| 97 | Ga0466735_079421 | 3300042624 | Bacteria | 1138 |
| 98 | Ga0466735_084160 | 3300042624 | Bacteria | 14030 |
| 99 | Ga0466735_227997 | 3300042624 | Bacteria | 6801 |
| 100 | Ga0466703_205020 | 3300042636 | Bacteria | 117626 |
| 101 | Ga0466704_033924 | 3300042643 | Bacteria | 8529 |
| 102 | Ga0466704_174557 | 3300042643 | Unclassified | 4623 |
| 103 | Ga0466705_112591 | 3300042612 | Bacteria | 37659 |
| 104 | Ga0466707_247197 | 3300042601 | Bacteria | 3747 |
| 105 | Ga0466707_345705 | 3300042601 | Bacteria | 6374 |
| 106 | Ga0466713_146356 | 3300042602 | Bacteria | 7482 |
| 107 | Ga0466705_512394 | 3300042612 | Bacteria | 1324 |
| 108 | Ga0466723_037148 | 3300042618 | Bacteria | 3519 |
| 109 | Ga0466726_004156 | 3300042619 | Bacteria | 19108 |
| 110 | Ga0466692_147669 | 3300042591 | Bacteria | 5622 |
| 111 | Ga0123357_10002974 | 3300009784 | Bacteria | 19171 |
| 112 | Ga0466729_303218 | 3300042621 | Bacteria | 5900 |
| 113 | Ga0466735_056245 | 3300042624 | Bacteria | 9993 |
| 114 | Ga0466704_531946 | 3300042643 | Bacteria | 7884 |
| 115 | Ga0466727_184905 | 3300042655 | Bacteria | 22963 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03167 | UDG | Uracil DNA glycosylase superfamily | 104 | 249 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.