Protein Family IF04539
Metagenome
Metatranscriptome
Isolate
186
Members
54
Samples
179
Scaffolds
197.91
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_236274|Ga0466690_236274_23_727
- Length
- 234 aa
- Sequence
- LRDFRFYPLLFANSLLYLPYLWLFSFSRAWYTAGMSSHEKTLSREQAWELLKTYNSDPFHLQHALTVEGVMRWYARELGFADEEDFWAVVGLLHDIDFERYPQEHCIKAPELLRAAGAGEDLIHGVCSHGYELTVDVKPDHLMEQVLYASDELTGLIWAAAIIRPSKSVQDMEVKSVRKKFKAANFAAGCSREVIEKGAAMLGWELDLLIERTIRAMRSCEAAVNAFMAEHYPQ
Sample Types
Isolate
3.8%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.3%
Kalotermitidae
26.4%
Unclassified
17.0%
Rhinotermitidae
7.5%
Termopsidae
3.8%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 2 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10614620 | 3300010049 | Unclassified | 1252 |
| 2 | Ga0123353_10020121 | 3300010167 | Bacteria | 9953 |
| 3 | Ga0123353_10615188 | 3300010167 | Bacteria | 1548 |
| 4 | Ga0123354_10186250 | 3300010882 | Bacteria | 2346 |
| 5 | Ga0466712_058277 | 3300042614 | Bacteria | 14833 |
| 6 | Ga0466712_101755 | 3300042614 | Bacteria | 13085 |
| 7 | Ga0466711_149904 | 3300042615 | Bacteria | 12480 |
| 8 | Ga0466711_433771 | 3300042615 | Bacteria | 1396 |
| 9 | Ga0466715_279032 | 3300042616 | Bacteria | 2629 |
| 10 | Ga0466726_300863 | 3300042619 | Bacteria | 11272 |
| 11 | Ga0466726_399596 | 3300042619 | Bacteria | 1743 |
| 12 | Ga0264413_122689 | 3300024493 | Bacteria | 25395 |
| 13 | Ga0466690_288249 | 3300042590 | Bacteria | 2107 |
| 14 | Ga0466690_299688 | 3300042590 | Bacteria | 1144 |
| 15 | Ga0466692_187811 | 3300042591 | Bacteria | 2865 |
| 16 | Ga0466691_017820 | 3300042593 | Bacteria | 4572 |
| 17 | Ga0466694_131750 | 3300042594 | Unclassified | 2094 |
| 18 | Ga0466694_262768 | 3300042594 | Bacteria | 3693 |
| 19 | Ga0466696_249678 | 3300042596 | Bacteria | 13570 |
| 20 | Ga0466699_035624 | 3300042597 | Bacteria | 1279 |
| 21 | Ga0466700_175126 | 3300042600 | Bacteria | 2205 |
| 22 | Ga0466720_039831 | 3300042607 | Bacteria | 4392 |
| 23 | JGI24698J34947_10000612 | 3300002449 | Bacteria | 17105 |
| 24 | JGI24698J34947_10022153 | 3300002449 | Bacteria | 3410 |
| 25 | JGI24702J35022_10177851 | 3300002462 | Bacteria | 1207 |
| 26 | Ga0466702_319944 | 3300042635 | Bacteria | 2314 |
| 27 | Ga0466709_130988 | 3300042648 | Bacteria | 2235 |
| 28 | Ga0466727_056608 | 3300042655 | Bacteria | 1052 |
| 29 | Ga0466727_240982 | 3300042655 | Bacteria | 1110 |
| 30 | Ga0123357_10091399 | 3300009784 | Bacteria | 3964 |
| 31 | Ga0123357_10265521 | 3300009784 | Bacteria | 1805 |
| 32 | Ga0123355_10001012 | 3300009826 | Bacteria | 38990 |
| 33 | Ga0123353_10102721 | 3300010167 | Bacteria | 4608 |
| 34 | Ga0466711_040621 | 3300042615 | Bacteria | 24207 |
| 35 | Ga0466723_117711 | 3300042618 | Bacteria | 2971 |
| 36 | Ga0466729_196442 | 3300042621 | Bacteria | 4923 |
| 37 | Ga0264413_102064 | 3300024493 | Bacteria | 14247 |
| 38 | Ga0466690_108200 | 3300042590 | Bacteria | 8276 |
| 39 | Ga0466694_113339 | 3300042594 | Bacteria | 4740 |
| 40 | Ga0466696_426303 | 3300042596 | Bacteria | 3476 |
| 41 | Ga0466707_281004 | 3300042601 | Bacteria | 3417 |
| 42 | Ga0466717_229932 | 3300042604 | Bacteria | 2354 |
| 43 | Ga0466720_177347 | 3300042607 | Bacteria | 1247 |
| 44 | Ga0466698_466451 | 3300042610 | Bacteria | 2554 |
| 45 | JGI24698J34947_10025195 | 3300002449 | Bacteria | 3168 |
| 46 | Ga0123357_10000067 | 3300009784 | Bacteria | 84688 |
| 47 | Ga0466705_106720 | 3300042612 | Bacteria | 5823 |
| 48 | Ga0466705_331907 | 3300042612 | Bacteria | 1228 |
| 49 | Ga0466702_091390 | 3300042635 | Bacteria | 2426 |
| 50 | Ga0466709_170494 | 3300042648 | Unclassified | 1114 |
| 51 | Ga0466727_151011 | 3300042655 | Bacteria | 16384 |
| 52 | Ga0123356_10315302 | 3300010049 | Bacteria | 1675 |
| 53 | Ga0123353_11398272 | 3300010167 | Bacteria | 900 |
| 54 | Ga0123354_10141172 | 3300010882 | Bacteria | 2978 |
| 55 | Ga0466723_054598 | 3300042618 | Bacteria | 5025 |
| 56 | Ga0466723_180857 | 3300042618 | Bacteria | 75146 |
| 57 | Ga0466723_348548 | 3300042618 | Bacteria | 2839 |
| 58 | Ga0466728_387061 | 3300042620 | Bacteria | 14937 |
| 59 | Ga0456237_0003546 | 3300041968 | Bacteria | 2524 |
| 60 | Ga0466690_236274 | 3300042590 | Bacteria | 2422 |
| 61 | Ga0466693_119413 | 3300042592 | Bacteria | 1089 |
| 62 | Ga0466691_137856 | 3300042593 | Bacteria | 4352 |
| 63 | Ga0466694_026062 | 3300042594 | Bacteria | 1101 |
| 64 | Ga0466694_263297 | 3300042594 | Bacteria | 1805 |
| 65 | Ga0466707_096920 | 3300042601 | Bacteria | 2464 |
| 66 | Ga0466719_209452 | 3300042606 | Bacteria | 6590 |
| 67 | Ga0466719_251342 | 3300042606 | Bacteria | 1109 |
| 68 | Ga0466719_520508 | 3300042606 | Bacteria | 1543 |
| 69 | Ga0466722_154827 | 3300042609 | Bacteria | 5733 |
| 70 | AustNasuHG_c1019283 | 3300000089 | Bacteria | 2240 |
| 71 | Ga0466703_390762 | 3300042636 | Bacteria | 30809 |
| 72 | Ga0466704_016572 | 3300042643 | Bacteria | 4282 |
| 73 | Ga0466708_121816 | 3300042652 | Bacteria | 1829 |
| 74 | Ga0466708_404987 | 3300042652 | Bacteria | 2732 |
| 75 | Ga0466727_296925 | 3300042655 | Bacteria | 1288 |
| 76 | Ga0466727_319441 | 3300042655 | Bacteria | 10779 |
| 77 | Ga0123353_10114223 | 3300010167 | Bacteria | 4347 |
| 78 | Ga0123353_10293974 | 3300010167 | Bacteria | 2485 |
| 79 | Ga0123353_10686207 | 3300010167 | Bacteria | 1441 |
| 80 | Ga0466711_228314 | 3300042615 | Bacteria | 8804 |
| 81 | Ga0466715_119403 | 3300042616 | Bacteria | 10481 |
| 82 | Ga0466715_366753 | 3300042616 | Bacteria | 6292 |
| 83 | Ga0466718_022078 | 3300042617 | Bacteria | 7093 |
| 84 | Ga0466718_041422 | 3300042617 | Unclassified | 1123 |
| 85 | Ga0466723_033728 | 3300042618 | Bacteria | 4792 |
| 86 | Ga0264413_112412 | 3300024493 | Bacteria | 8201 |
| 87 | Ga0264413_156441 | 3300024493 | Bacteria | 1565 |
| 88 | Ga0466694_080037 | 3300042594 | Bacteria | 1342 |
| 89 | Ga0466694_107266 | 3300042594 | Unclassified | 1469 |
| 90 | Ga0466694_351628 | 3300042594 | Bacteria | 3350 |
| 91 | Ga0466696_233851 | 3300042596 | Bacteria | 1692 |
| 92 | Ga0466699_018066 | 3300042597 | Bacteria | 4483 |
| 93 | Ga0466700_087636 | 3300042600 | Bacteria | 1174 |
| 94 | Ga0466717_071450 | 3300042604 | Bacteria | 1457 |
| 95 | Ga0466720_126727 | 3300042607 | Bacteria | 8725 |
| 96 | Ga0466722_147506 | 3300042609 | Bacteria | 4869 |
| 97 | JGI24698J34947_10001906 | 3300002449 | Bacteria | 11112 |
| 98 | JGI24698J34947_10002614 | 3300002449 | Bacteria | 9713 |
| 99 | JGI24698J34947_10004231 | 3300002449 | Bacteria | 7804 |
| 100 | JGI24705J35276_12214320 | 3300002504 | Bacteria | 1956 |
| 101 | Ga0466704_082558 | 3300042643 | Bacteria | 6077 |
| 102 | Ga0466704_135516 | 3300042643 | Bacteria | 50760 |
| 103 | Ga0466704_233628 | 3300042643 | Bacteria | 18824 |
| 104 | Ga0466704_540372 | 3300042643 | Bacteria | 1531 |
| 105 | Ga0466709_416240 | 3300042648 | Bacteria | 1010 |
| 106 | Ga0466708_110004 | 3300042652 | Bacteria | 1707 |
| 107 | Ga0466708_331133 | 3300042652 | Bacteria | 3266 |
| 108 | Ga0123355_10875572 | 3300009826 | Bacteria | 982 |
| 109 | Ga0123353_10077304 | 3300010167 | Bacteria | 5348 |
| 110 | Ga0123353_10246941 | 3300010167 | Bacteria | 2768 |
| 111 | Ga0123353_10907276 | 3300010167 | Bacteria | 1199 |
| 112 | Ga0123354_10216995 | 3300010882 | Bacteria | 2046 |
| 113 | Ga0466723_088527 | 3300042618 | Bacteria | 1224 |
| 114 | Ga0466726_057409 | 3300042619 | Bacteria | 4022 |
| 115 | Ga0222431_1033894 | 3300021190 | Bacteria | 1240 |
| 116 | Ga0415639_036338 | 3300038395 | Bacteria | 2669 |
| 117 | Ga0466690_015124 | 3300042590 | Bacteria | 9096 |
| 118 | Ga0466690_401862 | 3300042590 | Bacteria | 1581 |
| 119 | Ga0466691_180505 | 3300042593 | Bacteria | 1586 |
| 120 | Ga0466699_004950 | 3300042597 | Bacteria | 1215 |
| 121 | Ga0466701_007295 | 3300042598 | Bacteria | 1206 |
| 122 | Ga0466716_142568 | 3300042605 | Bacteria | 11917 |
| 123 | Ga0466719_377327 | 3300042606 | Bacteria | 5604 |
| 124 | AustNasuHG_c1016112 | 3300000089 | Bacteria | 2507 |
| 125 | JGI24705J35276_11808091 | 3300002504 | Bacteria | 688 |
| 126 | Ga0466705_237685 | 3300042612 | Bacteria | 3335 |
| 127 | Ga0466731_028788 | 3300042622 | Bacteria | 4387 |
| 128 | Ga0466703_053807 | 3300042636 | Bacteria | 7175 |
| 129 | Ga0466704_070864 | 3300042643 | Bacteria | 2327 |
| 130 | Ga0466709_116315 | 3300042648 | Bacteria | 12421 |
| 131 | Ga0466708_021098 | 3300042652 | Bacteria | 2846 |
| 132 | Ga0466727_239080 | 3300042655 | Bacteria | 5835 |
| 133 | Ga0123357_10013430 | 3300009784 | Bacteria | 10634 |
| 134 | Ga0466712_045507 | 3300042614 | Bacteria | 29349 |
| 135 | Ga0466712_203901 | 3300042614 | Bacteria | 7858 |
| 136 | Ga0466711_207885 | 3300042615 | Bacteria | 3195 |
| 137 | Ga0466711_334911 | 3300042615 | Bacteria | 18342 |
| 138 | Ga0466723_337979 | 3300042618 | Bacteria | 2179 |
| 139 | Ga0466728_158225 | 3300042620 | Bacteria | 5181 |
| 140 | Ga0466692_093679 | 3300042591 | Bacteria | 1113 |
| 141 | Ga0466694_002495 | 3300042594 | Bacteria | 1136 |
| 142 | Ga0466716_114098 | 3300042605 | Bacteria | 9273 |
| 143 | Ga0466720_137263 | 3300042607 | Unclassified | 1319 |
| 144 | Ga0466720_211900 | 3300042607 | Unclassified | 1033 |
| 145 | JGI24702J35022_10003302 | 3300002462 | Bacteria | 9740 |
| 146 | JGI24702J35022_10035556 | 3300002462 | Bacteria | 2665 |
| 147 | Ga0466703_068901 | 3300042636 | Bacteria | 2682 |
| 148 | Ga0466704_069699 | 3300042643 | Bacteria | 10342 |
| 149 | Ga0466704_462480 | 3300042643 | Bacteria | 8020 |
| 150 | Ga0123354_10446591 | 3300010882 | Bacteria | 1051 |
| 151 | Ga0466711_274233 | 3300042615 | Bacteria | 1361 |
| 152 | Ga0466711_411912 | 3300042615 | Bacteria | 2601 |
| 153 | Ga0466715_634842 | 3300042616 | Bacteria | 2102 |
| 154 | Ga0466690_173118 | 3300042590 | Bacteria | 13834 |
| 155 | Ga0466691_136040 | 3300042593 | Bacteria | 29545 |
| 156 | Ga0466694_150083 | 3300042594 | Bacteria | 1081 |
| 157 | Ga0466700_175801 | 3300042600 | Bacteria | 1024 |
| 158 | Ga0466720_156055 | 3300042607 | Bacteria | 1484 |
| 159 | Ga0466698_245276 | 3300042610 | Bacteria | 1461 |
| 160 | Ga0466705_164720 | 3300042612 | Bacteria | 17960 |
| 161 | Ga0466712_192186 | 3300042614 | Bacteria | 7953 |
| 162 | Ga0466712_317171 | 3300042614 | Unclassified | 3443 |
| 163 | Ga0466718_119371 | 3300042617 | Bacteria | 2692 |
| 164 | Ga0264413_101765 | 3300024493 | Bacteria | 5328 |
| 165 | Ga0264413_117529 | 3300024493 | Bacteria | 7676 |
| 166 | Ga0415639_162949 | 3300038395 | Bacteria | 1594 |
| 167 | Ga0466692_057957 | 3300042591 | Bacteria | 4825 |
| 168 | Ga0466694_073380 | 3300042594 | Bacteria | 10133 |
| 169 | Ga0466694_089694 | 3300042594 | Bacteria | 3231 |
| 170 | Ga0466700_199961 | 3300042600 | Bacteria | 1281 |
| 171 | Ga0466713_096967 | 3300042602 | Bacteria | 1686 |
| 172 | JGI24698J34947_10004370 | 3300002449 | Bacteria | 7688 |
| 173 | JGI24698J34947_10071303 | 3300002449 | Bacteria | 1668 |
| 174 | Ga0072940_1030202 | 3300005200 | Bacteria | 3049 |
| 175 | Ga0466703_248499 | 3300042636 | Bacteria | 1885 |
| 176 | Ga0466703_400866 | 3300042636 | Bacteria | 1146 |
| 177 | Ga0466704_125800 | 3300042643 | Bacteria | 10107 |
| 178 | Ga0466704_433116 | 3300042643 | Bacteria | 8034 |
| 179 | Ga0466709_013987 | 3300042648 | Bacteria | 4570 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.