Protein Family IF04533
Metagenome
Metatranscriptome
Isolate
145
Members
42
Samples
137
Scaffolds
375.37
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_216101|Ga0466690_216101_219_1394
- Length
- 386 aa
- Sequence
- VFIYIPFNKEHSMSINKVKTAVVGCGTISDIYLKNMTGAFEILDVVGCCDIIPERMAKRAGQYNIKQMKIEEILNNPDLELVLNITDPVNHHLVSSQVLNAGKHLYSEKPIDLSIEAARELVQLADQKKLLYGNAPDTFLGQAIQTARFYLDAGVIGDVTSVYATLNRDELYPFTALPGGGIGLDVGVYYITAILSILGPVKEVSGFVDTLRAERTHYFPNKDDFGQKFVLQAENRVVGSFRFANGVMGSLMFNSCSIGNEKPQIVMFGTEGILYMPDPNQFGGEVKVILKGQTEPITLAPTHGFTENSRGIGPAELAWSLRRGRKPRTSKEMAFHGLELLLGLYKSCETKQFYQMTSSFERPPAVPRGYLGEGYGGSPAEAGIAV
Sample Types
Isolate
4.8%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.1%
Termitidae
31.7%
Unclassified
14.6%
Rhinotermitidae
7.3%
Termopsidae
7.3%
Hodotermitidae
2.4%
Blaberidae
2.4%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 37 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_210356 | 3300042612 | Unclassified | 6827 |
| 2 | Ga0123357_10045241 | 3300009784 | Bacteria | 5972 |
| 3 | Ga0466711_065095 | 3300042615 | Bacteria | 13279 |
| 4 | Ga0466715_040033 | 3300042616 | Bacteria | 5285 |
| 5 | Ga0466715_137897 | 3300042616 | Bacteria | 2418 |
| 6 | Ga0466715_302459 | 3300042616 | Unclassified | 9013 |
| 7 | Ga0466726_263004 | 3300042619 | Bacteria | 1871 |
| 8 | Ga0466726_285600 | 3300042619 | Unclassified | 1155 |
| 9 | Ga0466690_216101 | 3300042590 | Bacteria | 2853 |
| 10 | Ga0466690_271286 | 3300042590 | Unclassified | 2175 |
| 11 | Ga0466690_279870 | 3300042590 | Bacteria | 2136 |
| 12 | Ga0466692_088411 | 3300042591 | Bacteria | 10167 |
| 13 | Ga0466694_029496 | 3300042594 | Bacteria | 2202 |
| 14 | Ga0466694_107642 | 3300042594 | Bacteria | 9369 |
| 15 | Ga0466699_256893 | 3300042597 | Bacteria | 1991 |
| 16 | Ga0466706_111462 | 3300042599 | Bacteria | 4495 |
| 17 | Ga0466716_057424 | 3300042605 | Unclassified | 4094 |
| 18 | Ga0466716_131249 | 3300042605 | Bacteria | 11314 |
| 19 | Ga0466716_327237 | 3300042605 | Unclassified | 3860 |
| 20 | Ga0466722_134119 | 3300042609 | Bacteria | 1491 |
| 21 | Ga0466703_013993 | 3300042636 | Bacteria | 19436 |
| 22 | Ga0466703_154307 | 3300042636 | Unclassified | 4358 |
| 23 | Ga0466704_241045 | 3300042643 | Bacteria | 4892 |
| 24 | Ga0466704_339320 | 3300042643 | Bacteria | 14735 |
| 25 | Ga0123357_10000294 | 3300009784 | Bacteria | 47833 |
| 26 | Ga0466705_098563 | 3300042612 | Bacteria | 5944 |
| 27 | Ga0466705_342791 | 3300042612 | Bacteria | 3550 |
| 28 | Ga0466705_357343 | 3300042612 | Bacteria | 1558 |
| 29 | Ga0466733_078348 | 3300042659 | Bacteria | 4434 |
| 30 | Ga0123353_10060818 | 3300010167 | Bacteria | 6056 |
| 31 | Ga0466712_195764 | 3300042614 | Bacteria | 9065 |
| 32 | Ga0466711_012004 | 3300042615 | Bacteria | 25076 |
| 33 | Ga0466711_376418 | 3300042615 | Bacteria | 6825 |
| 34 | Ga0466723_093729 | 3300042618 | Bacteria | 11545 |
| 35 | Ga0466696_241330 | 3300042596 | Unclassified | 1499 |
| 36 | Ga0466707_108624 | 3300042601 | Bacteria | 1246 |
| 37 | Ga0466722_064990 | 3300042609 | Bacteria | 9267 |
| 38 | Ga0466704_584008 | 3300042643 | Unclassified | 1760 |
| 39 | Ga0466704_589616 | 3300042643 | Unclassified | 4605 |
| 40 | Ga0466709_366458 | 3300042648 | Bacteria | 1747 |
| 41 | Ga0466708_342285 | 3300042652 | Bacteria | 16446 |
| 42 | Ga0466727_153191 | 3300042655 | Unclassified | 1314 |
| 43 | JGI24698J34947_10004549 | 3300002449 | Unclassified | 7556 |
| 44 | JGI24702J35022_10064094 | 3300002462 | Bacteria | 1970 |
| 45 | Ga0466712_078139 | 3300042614 | Bacteria | 11617 |
| 46 | Ga0466712_089040 | 3300042614 | Bacteria | 4550 |
| 47 | Ga0466718_044414 | 3300042617 | Bacteria | 6973 |
| 48 | Ga0466691_029500 | 3300042593 | Bacteria | 7308 |
| 49 | Ga0466699_146176 | 3300042597 | Bacteria | 1172 |
| 50 | Ga0466716_179148 | 3300042605 | Bacteria | 6158 |
| 51 | Ga0466719_355368 | 3300042606 | Unclassified | 3850 |
| 52 | Ga0466720_079491 | 3300042607 | Bacteria | 1684 |
| 53 | Ga0466709_180071 | 3300042648 | Bacteria | 7510 |
| 54 | JGI24698J34947_10005329 | 3300002449 | Bacteria | 7056 |
| 55 | JGI24698J34947_10050925 | 3300002449 | Bacteria | 2086 |
| 56 | Ga0123357_10042207 | 3300009784 | Bacteria | 6203 |
| 57 | Ga0123354_10290436 | 3300010882 | Bacteria | 1568 |
| 58 | Ga0466712_023288 | 3300042614 | Unclassified | 12251 |
| 59 | Ga0466712_197350 | 3300042614 | Bacteria | 26294 |
| 60 | Ga0466711_064831 | 3300042615 | Bacteria | 3056 |
| 61 | Ga0466711_197226 | 3300042615 | Bacteria | 15378 |
| 62 | Ga0466723_202076 | 3300042618 | Bacteria | 15793 |
| 63 | Ga0466726_287435 | 3300042619 | Bacteria | 2259 |
| 64 | Ga0466690_029057 | 3300042590 | Unclassified | 1648 |
| 65 | Ga0466690_134643 | 3300042590 | Bacteria | 6180 |
| 66 | Ga0466691_033964 | 3300042593 | Bacteria | 5542 |
| 67 | Ga0466696_019198 | 3300042596 | Unclassified | 3724 |
| 68 | Ga0466696_063061 | 3300042596 | Bacteria | 1312 |
| 69 | Ga0466716_069357 | 3300042605 | Bacteria | 12001 |
| 70 | Ga0466703_231978 | 3300042636 | Bacteria | 6909 |
| 71 | Ga0466704_099676 | 3300042643 | Bacteria | 8238 |
| 72 | Ga0466727_284785 | 3300042655 | Bacteria | 1168 |
| 73 | Ga0466705_193055 | 3300042612 | Bacteria | 6489 |
| 74 | Ga0466705_203005 | 3300042612 | Bacteria | 6934 |
| 75 | Ga0123357_10078472 | 3300009784 | Bacteria | 4351 |
| 76 | Ga0466711_204018 | 3300042615 | Bacteria | 2742 |
| 77 | Ga0466711_471676 | 3300042615 | Bacteria | 5925 |
| 78 | Ga0466723_258566 | 3300042618 | Bacteria | 3640 |
| 79 | Ga0466728_013908 | 3300042620 | Bacteria | 19460 |
| 80 | Ga0223677_1018565 | 3300021239 | Bacteria | 1277 |
| 81 | Ga0466696_112649 | 3300042596 | Bacteria | 4998 |
| 82 | Ga0466699_225841 | 3300042597 | Bacteria | 9280 |
| 83 | Ga0466699_311069 | 3300042597 | Bacteria | 4923 |
| 84 | Ga0466707_141592 | 3300042601 | Bacteria | 3638 |
| 85 | Ga0466716_426572 | 3300042605 | Bacteria | 4772 |
| 86 | Ga0466703_070922 | 3300042636 | Bacteria | 6833 |
| 87 | Ga0466703_235899 | 3300042636 | Bacteria | 23764 |
| 88 | Ga0466704_114214 | 3300042643 | Bacteria | 6163 |
| 89 | Ga0466708_158552 | 3300042652 | Bacteria | 10346 |
| 90 | Ga0466727_241961 | 3300042655 | Bacteria | 2595 |
| 91 | Ga0466733_070077 | 3300042659 | Bacteria | 1408 |
| 92 | Ga0123353_10112391 | 3300010167 | Bacteria | 4386 |
| 93 | Ga0466711_292537 | 3300042615 | Bacteria | 2327 |
| 94 | Ga0466726_452581 | 3300042619 | Bacteria | 3050 |
| 95 | Ga0456237_0000262 | 3300041968 | Bacteria | 7736 |
| 96 | Ga0466692_181579 | 3300042591 | Bacteria | 2473 |
| 97 | Ga0466699_119942 | 3300042597 | Bacteria | 9955 |
| 98 | Ga0466719_121190 | 3300042606 | Unclassified | 2417 |
| 99 | Ga0466719_177023 | 3300042606 | Bacteria | 5282 |
| 100 | Ga0466704_036310 | 3300042643 | Bacteria | 6099 |
| 101 | Ga0466709_254255 | 3300042648 | Bacteria | 4622 |
| 102 | JGI24698J34947_10002096 | 3300002449 | Bacteria | 10663 |
| 103 | JGI24695J34938_10001877 | 3300002450 | Bacteria | 17078 |
| 104 | Ga0466705_008895 | 3300042612 | Bacteria | 6848 |
| 105 | Ga0123357_10052198 | 3300009784 | Bacteria | 5522 |
| 106 | Ga0466715_052358 | 3300042616 | Bacteria | 13944 |
| 107 | Ga0466726_475314 | 3300042619 | Bacteria | 2378 |
| 108 | Ga0466690_031602 | 3300042590 | Bacteria | 1646 |
| 109 | Ga0466694_309406 | 3300042594 | Bacteria | 10427 |
| 110 | Ga0466699_093955 | 3300042597 | Bacteria | 1503 |
| 111 | Ga0466699_323936 | 3300042597 | Unclassified | 1261 |
| 112 | Ga0466719_157218 | 3300042606 | Bacteria | 10312 |
| 113 | Ga0466735_116719 | 3300042624 | Bacteria | 7734 |
| 114 | Ga0466702_339009 | 3300042635 | Bacteria | 8822 |
| 115 | Ga0466703_061536 | 3300042636 | Bacteria | 11698 |
| 116 | Ga0466708_242265 | 3300042652 | Bacteria | 10690 |
| 117 | Ga0466708_319821 | 3300042652 | Bacteria | 5307 |
| 118 | Ga0466727_305901 | 3300042655 | Bacteria | 10053 |
| 119 | JGI24698J34947_10006576 | 3300002449 | Unclassified | 6384 |
| 120 | Ga0123353_10083877 | 3300010167 | Bacteria | 5129 |
| 121 | Ga0466712_018294 | 3300042614 | Unclassified | 19252 |
| 122 | Ga0466712_055102 | 3300042614 | Bacteria | 7330 |
| 123 | Ga0466723_103387 | 3300042618 | Unclassified | 1950 |
| 124 | Ga0466690_059153 | 3300042590 | Unclassified | 1544 |
| 125 | Ga0466692_094597 | 3300042591 | Bacteria | 2461 |
| 126 | Ga0466692_185134 | 3300042591 | Bacteria | 6483 |
| 127 | Ga0466691_025735 | 3300042593 | Bacteria | 7688 |
| 128 | Ga0466696_341581 | 3300042596 | Bacteria | 4691 |
| 129 | Ga0466719_064782 | 3300042606 | Bacteria | 13923 |
| 130 | Ga0466719_469388 | 3300042606 | Bacteria | 20806 |
| 131 | Ga0466722_070485 | 3300042609 | Bacteria | 12999 |
| 132 | Ga0466722_159471 | 3300042609 | Bacteria | 1655 |
| 133 | Ga0466722_267967 | 3300042609 | Bacteria | 1947 |
| 134 | Ga0466704_210106 | 3300042643 | Bacteria | 10055 |
| 135 | Ga0466709_127489 | 3300042648 | Bacteria | 16562 |
| 136 | Ga0466708_088013 | 3300042652 | Bacteria | 8738 |
| 137 | JGI24698J34947_10035693 | 3300002449 | Bacteria | 2593 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.