Protein Family IF04514
Metagenome
Isolate
241
Members
77
Samples
212
Scaffolds
657.71
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_172738|Ga0466690_172738_38325_40604
- Length
- 759 aa
- Sequence
- MIDKYTADRIYNAAQIVDVVSDFVTLRKRGANYVGLCPFHSDNTPSFHVSPSKNICKCFACGEGGTSVQFIMKHEQISYYEALRYLAKKYNIEIRERELTDEEKHMQSDRESMVIINNWAQKFFASRLYEHEEGRRIAMSYFTERGFRDDIVRKFQLGYSLNKRDDLYANATEHGFNEIYLLKTGLVYKRDDGAIADRFHGRVIFPVHTLSGKVIAFGGRILGKKDKVAKYINSPESEIYHKSNELYGIYFARQAIVRADKCYLVEGYTDVISMHQTGIENVVASSGTSLTDGQIRLIHRFTNNITVLYDGDAAGIKAAIRGIDMLLAEGMNVKVVLLPEGEDPDSFARSHNSFDFTLYINEHEVDFIRFKAGLLLKEADDDPVKRINLIKEMMETIAVIPDNITRSVYIKECSHLFDGREQLLMDEVMKIRGRRSRSVQKMPGQRTSPPALSALSDSNLSASAQTTFAQPDSPSMIPAQSTSDVRTTPFPPASARTASDQMIWDGELATLTPNDYPPDVTTETKEGGAATGDITGKTETPVNNRDYKYSPFKKYESILLRYVIRYGERILFVDKKSDENGDIERLVSVAEYIQSELQKDEIEIQTPIYKRILEEAIVQSENEGFTASHYFLTHSDLEISKLATDMISSKYSLSKYFYNPEDVALKQTTLSDERQEAENEARKRXKERDQLERWVVHDIFTLKNAYIKHKIDDVNKQMREFRSDEEKVMTLLKKRMELDRTKIKLSKALGDRIVTGIGE
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.4%
Blattidae
19.5%
Kalotermitidae
18.2%
Unclassified
15.6%
Rhinotermitidae
6.5%
Armadillidiidae
5.2%
Termopsidae
3.9%
Passalidae
2.6%
Hydrophilidae
2.6%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 2 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 3 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 14 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 19 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 20 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 21 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 22 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 25 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 31 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 32 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 40 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 60 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 61 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 62 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 63 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 64 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 65 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 66 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 67 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 68 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 69 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 70 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 71 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 72 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 73 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 74 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 75 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 76 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 77 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_004413 | 3300042612 | Bacteria | 6122 |
| 2 | Ga0466733_110450 | 3300042659 | Bacteria | 40709 |
| 3 | Ga0466715_009406 | 3300042616 | Bacteria | 67720 |
| 4 | Ga0466715_117721 | 3300042616 | Bacteria | 5545 |
| 5 | Ga0466715_125413 | 3300042616 | Bacteria | 7398 |
| 6 | Ga0466715_265152 | 3300042616 | Bacteria | 6027 |
| 7 | Ga0466715_304466 | 3300042616 | Bacteria | 8317 |
| 8 | Ga0466723_047670 | 3300042618 | Bacteria | 16534 |
| 9 | Ga0466701_047675 | 3300042598 | Bacteria | 4166 |
| 10 | Ga0466706_081386 | 3300042599 | Bacteria | 4301 |
| 11 | Ga0466706_105640 | 3300042599 | Bacteria | 39915 |
| 12 | Ga0466713_038044 | 3300042602 | Bacteria | 17226 |
| 13 | Ga0466713_077466 | 3300042602 | Bacteria | 18852 |
| 14 | Ga0466713_082368 | 3300042602 | Bacteria | 6872 |
| 15 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 16 | Ga0466717_072598 | 3300042604 | Bacteria | 3923 |
| 17 | Ga0466716_102225 | 3300042605 | Bacteria | 13051 |
| 18 | Ga0466729_253528 | 3300042621 | Bacteria | 21930 |
| 19 | Ga0466735_039223 | 3300042624 | Bacteria | 15993 |
| 20 | Ga0466735_093862 | 3300042624 | Bacteria | 8309 |
| 21 | Ga0466735_121061 | 3300042624 | Bacteria | 3415 |
| 22 | Ga0466735_194557 | 3300042624 | Bacteria | 3601 |
| 23 | Ga0466730_057655 | 3300042625 | Bacteria | 4426 |
| 24 | Ga0466703_314483 | 3300042636 | Bacteria | 6345 |
| 25 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 26 | Ga0466704_254192 | 3300042643 | Bacteria | 18084 |
| 27 | Ga0466709_069983 | 3300042648 | Bacteria | 5831 |
| 28 | Ga0466727_108007 | 3300042655 | Bacteria | 8191 |
| 29 | 2227524636 | 2225789004 | Bacteria | 16862 |
| 30 | IMNBL1DRAFT_c0008777 | 3300000062 | Bacteria | 5098 |
| 31 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 32 | Ga0068305_10016637 | 3300005083 | Bacteria | 21059 |
| 33 | Ga0160469_101296 | 3300012824 | Unclassified | 7055 |
| 34 | Ga0160445_100403 | 3300012847 | Bacteria | 23773 |
| 35 | Ga0466690_058719 | 3300042590 | Bacteria | 19075 |
| 36 | Ga0466690_172738 | 3300042590 | Bacteria | 57212 |
| 37 | Ga0466690_213399 | 3300042590 | Bacteria | 31259 |
| 38 | Ga0466691_091359 | 3300042593 | Bacteria | 169365 |
| 39 | Ga0466710_004099 | 3300042613 | Bacteria | 12802 |
| 40 | Ga0466711_040127 | 3300042615 | Bacteria | 5853 |
| 41 | Ga0466711_043069 | 3300042615 | Bacteria | 11918 |
| 42 | Ga0466711_347073 | 3300042615 | Bacteria | 35232 |
| 43 | Ga0466728_071543 | 3300042620 | Bacteria | 7329 |
| 44 | Ga0466706_053146 | 3300042599 | Bacteria | 5517 |
| 45 | Ga0466706_055172 | 3300042599 | Bacteria | 72109 |
| 46 | Ga0466707_010232 | 3300042601 | Bacteria | 5492 |
| 47 | Ga0466707_185441 | 3300042601 | Bacteria | 8669 |
| 48 | Ga0466707_192374 | 3300042601 | Bacteria | 3221 |
| 49 | Ga0466713_129617 | 3300042602 | Bacteria | 20656 |
| 50 | Ga0466714_155925 | 3300042603 | Bacteria | 12391 |
| 51 | Ga0466719_222230 | 3300042606 | Bacteria | 4142 |
| 52 | Ga0466719_475113 | 3300042606 | Bacteria | 6093 |
| 53 | Ga0466721_253481 | 3300042608 | Bacteria | 27977 |
| 54 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 55 | Ga0466729_273173 | 3300042621 | Bacteria | 5065 |
| 56 | Ga0466703_199067 | 3300042636 | Bacteria | 3831 |
| 57 | Ga0466709_245877 | 3300042648 | Bacteria | 9500 |
| 58 | Ga0466724_57528 | 3300042649 | Bacteria | 5576 |
| 59 | Ga0466727_259735 | 3300042655 | Bacteria | 15797 |
| 60 | Ga0123354_10004434 | 3300010882 | Bacteria | 19900 |
| 61 | JGI24702J35022_10002964 | 3300002462 | Bacteria | 10272 |
| 62 | JGI24702J35022_10003669 | 3300002462 | Bacteria | 9239 |
| 63 | JGI24705J35276_12224540 | 3300002504 | Bacteria | 2621 |
| 64 | Ga0123357_10000662 | 3300009784 | Bacteria | 34422 |
| 65 | Ga0466657_038921 | 3300042582 | Bacteria | 11436 |
| 66 | Ga0466696_077461 | 3300042596 | Bacteria | 10279 |
| 67 | Ga0466705_046808 | 3300042612 | Bacteria | 25523 |
| 68 | Ga0466726_233725 | 3300042619 | Bacteria | 3096 |
| 69 | Ga0466726_271290 | 3300042619 | Bacteria | 6858 |
| 70 | Ga0466726_371181 | 3300042619 | Bacteria | 11544 |
| 71 | Ga0466706_127995 | 3300042599 | Bacteria | 4829 |
| 72 | Ga0466706_192891 | 3300042599 | Bacteria | 26478 |
| 73 | Ga0466707_131171 | 3300042601 | Bacteria | 11165 |
| 74 | Ga0466713_019827 | 3300042602 | Bacteria | 4839 |
| 75 | Ga0466713_102508 | 3300042602 | Unclassified | 8446 |
| 76 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 77 | Ga0466722_111299 | 3300042609 | Bacteria | 5447 |
| 78 | Ga0466729_247937 | 3300042621 | Bacteria | 4333 |
| 79 | Ga0466703_411030 | 3300042636 | Bacteria | 3837 |
| 80 | Ga0466704_231510 | 3300042643 | Bacteria | 12191 |
| 81 | Ga0466727_036767 | 3300042655 | Bacteria | 15833 |
| 82 | Ga0466727_301207 | 3300042655 | Bacteria | 13153 |
| 83 | Ga0123353_10000499 | 3300010167 | Bacteria | 48625 |
| 84 | 2227607943 | 2225789004 | Bacteria | 12222 |
| 85 | IMNBL1DRAFT_c0000384 | 3300000062 | Bacteria | 37809 |
| 86 | Ga0123357_10001146 | 3300009784 | Bacteria | 27559 |
| 87 | Ga0160468_100065 | 3300012819 | Bacteria | 140978 |
| 88 | Ga0466690_046586 | 3300042590 | Bacteria | 8503 |
| 89 | Ga0466696_054357 | 3300042596 | Bacteria | 37826 |
| 90 | Ga0466697_163544 | 3300042611 | Bacteria | 8660 |
| 91 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 92 | Ga0466715_240118 | 3300042616 | Bacteria | 29584 |
| 93 | Ga0466715_548749 | 3300042616 | Bacteria | 16600 |
| 94 | Ga0466723_057399 | 3300042618 | Bacteria | 11577 |
| 95 | Ga0466728_166131 | 3300042620 | Bacteria | 8079 |
| 96 | Ga0466707_377635 | 3300042601 | Bacteria | 12151 |
| 97 | Ga0466713_119805 | 3300042602 | Bacteria | 79435 |
| 98 | Ga0466719_055757 | 3300042606 | Bacteria | 33722 |
| 99 | Ga0466722_107967 | 3300042609 | Bacteria | 4831 |
| 100 | Ga0466735_179643 | 3300042624 | Bacteria | 2569 |
| 101 | Ga0466704_257824 | 3300042643 | Bacteria | 23792 |
| 102 | Ga0466725_141888 | 3300042654 | Bacteria | 11341 |
| 103 | Ga0466727_153723 | 3300042655 | Bacteria | 2939 |
| 104 | Ga0123356_10066955 | 3300010049 | Bacteria | 3363 |
| 105 | Ga0123353_10111532 | 3300010167 | Bacteria | 4405 |
| 106 | Ga0068305_10010856 | 3300005083 | Bacteria | 14545 |
| 107 | Ga0160433_100181 | 3300012846 | Bacteria | 51962 |
| 108 | Ga0466696_324178 | 3300042596 | Bacteria | 4116 |
| 109 | Ga0466696_475058 | 3300042596 | Bacteria | 5985 |
| 110 | Ga0466732_007018 | 3300042656 | Bacteria | 6125 |
| 111 | Ga0466715_090798 | 3300042616 | Bacteria | 3502 |
| 112 | Ga0466723_367142 | 3300042618 | Bacteria | 7612 |
| 113 | Ga0466706_053989 | 3300042599 | Bacteria | 17416 |
| 114 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 115 | Ga0466707_361813 | 3300042601 | Bacteria | 12501 |
| 116 | Ga0466713_058807 | 3300042602 | Bacteria | 13735 |
| 117 | Ga0466716_086550 | 3300042605 | Bacteria | 19403 |
| 118 | Ga0466722_080343 | 3300042609 | Bacteria | 16839 |
| 119 | Ga0466697_011496 | 3300042611 | Bacteria | 51969 |
| 120 | Ga0466735_083854 | 3300042624 | Bacteria | 2862 |
| 121 | Ga0466709_140267 | 3300042648 | Bacteria | 28990 |
| 122 | Ga0123357_10126919 | 3300009784 | Bacteria | 3192 |
| 123 | Ga0123353_10061083 | 3300010167 | Bacteria | 6043 |
| 124 | Ga0123354_10002434 | 3300010882 | Bacteria | 24588 |
| 125 | IMNBL1DRAFT_c0010391 | 3300000062 | Bacteria | 4463 |
| 126 | IMNBL1DRAFT_c0016795 | 3300000062 | Bacteria | 3114 |
| 127 | Ga0466690_208472 | 3300042590 | Bacteria | 11925 |
| 128 | Ga0466690_402774 | 3300042590 | Bacteria | 11069 |
| 129 | Ga0466691_022383 | 3300042593 | Bacteria | 23421 |
| 130 | Ga0466696_181576 | 3300042596 | Bacteria | 6528 |
| 131 | Ga0466733_064266 | 3300042659 | Bacteria | 6283 |
| 132 | Ga0466710_165584 | 3300042613 | Unclassified | 7014 |
| 133 | Ga0466715_307197 | 3300042616 | Bacteria | 27739 |
| 134 | Ga0466715_321517 | 3300042616 | Bacteria | 3743 |
| 135 | Ga0466715_458520 | 3300042616 | Bacteria | 8601 |
| 136 | Ga0466723_190749 | 3300042618 | Bacteria | 41750 |
| 137 | Ga0466728_257466 | 3300042620 | Bacteria | 6677 |
| 138 | Ga0466707_188687 | 3300042601 | Bacteria | 10744 |
| 139 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 140 | Ga0466719_015462 | 3300042606 | Bacteria | 9666 |
| 141 | Ga0466703_075647 | 3300042636 | Bacteria | 21491 |
| 142 | Ga0466703_383067 | 3300042636 | Bacteria | 2847 |
| 143 | Ga0466709_027878 | 3300042648 | Bacteria | 5136 |
| 144 | Ga0466708_044096 | 3300042652 | Bacteria | 70438 |
| 145 | Ga0466708_292277 | 3300042652 | Bacteria | 30652 |
| 146 | Ga0123357_10006139 | 3300009784 | Bacteria | 14562 |
| 147 | IMNBL1DRAFT_c0002685 | 3300000062 | Bacteria | 12147 |
| 148 | JGI24702J35022_10026185 | 3300002462 | Bacteria | 3143 |
| 149 | JGI24705J35276_12238303 | 3300002504 | Bacteria | 18959 |
| 150 | Ga0466690_042304 | 3300042590 | Bacteria | 9883 |
| 151 | Ga0466691_006250 | 3300042593 | Bacteria | 8667 |
| 152 | Ga0466696_160607 | 3300042596 | Bacteria | 11793 |
| 153 | Ga0466705_358603 | 3300042612 | Bacteria | 26821 |
| 154 | Ga0466733_032742 | 3300042659 | Unclassified | 6534 |
| 155 | Ga0466733_098295 | 3300042659 | Bacteria | 47070 |
| 156 | Ga0466733_181390 | 3300042659 | Bacteria | 5500 |
| 157 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 158 | Ga0466715_028764 | 3300042616 | Bacteria | 6954 |
| 159 | Ga0466715_222450 | 3300042616 | Bacteria | 11588 |
| 160 | Ga0466715_542695 | 3300042616 | Bacteria | 15092 |
| 161 | Ga0466728_057042 | 3300042620 | Bacteria | 28719 |
| 162 | Ga0466728_234918 | 3300042620 | Bacteria | 4366 |
| 163 | Ga0466728_333993 | 3300042620 | Bacteria | 5579 |
| 164 | Ga0466706_023757 | 3300042599 | Bacteria | 27793 |
| 165 | Ga0466713_060328 | 3300042602 | Bacteria | 119085 |
| 166 | Ga0466719_450712 | 3300042606 | Bacteria | 11900 |
| 167 | Ga0466722_021127 | 3300042609 | Bacteria | 2767 |
| 168 | Ga0466722_068382 | 3300042609 | Bacteria | 3054 |
| 169 | Ga0466722_088281 | 3300042609 | Bacteria | 7425 |
| 170 | Ga0466735_013877 | 3300042624 | Bacteria | 4258 |
| 171 | Ga0466703_335341 | 3300042636 | Bacteria | 10091 |
| 172 | Ga0466704_065433 | 3300042643 | Bacteria | 13281 |
| 173 | Ga0466704_153119 | 3300042643 | Bacteria | 6789 |
| 174 | Ga0466704_343809 | 3300042643 | Bacteria | 5884 |
| 175 | Ga0466708_061761 | 3300042652 | Bacteria | 24390 |
| 176 | Ga0123353_10073987 | 3300010167 | Bacteria | 5477 |
| 177 | 2227444694 | 2225789004 | Bacteria | 5467 |
| 178 | Ga0160445_100097 | 3300012847 | Bacteria | 88551 |
| 179 | Ga0466690_238245 | 3300042590 | Bacteria | 6928 |
| 180 | Ga0466691_034693 | 3300042593 | Bacteria | 6170 |
| 181 | Ga0466691_035670 | 3300042593 | Bacteria | 11664 |
| 182 | Ga0466691_058338 | 3300042593 | Bacteria | 8322 |
| 183 | Ga0466691_081545 | 3300042593 | Bacteria | 5632 |
| 184 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 185 | Ga0466733_070989 | 3300042659 | Bacteria | 25252 |
| 186 | Ga0466733_211287 | 3300042659 | Bacteria | 6139 |
| 187 | Ga0466705_490256 | 3300042612 | Bacteria | 7493 |
| 188 | Ga0466715_153096 | 3300042616 | Bacteria | 36493 |
| 189 | Ga0466723_013868 | 3300042618 | Bacteria | 21533 |
| 190 | Ga0466723_202271 | 3300042618 | Bacteria | 31309 |
| 191 | Ga0466728_174203 | 3300042620 | Bacteria | 15013 |
| 192 | Ga0466706_082742 | 3300042599 | Bacteria | 3481 |
| 193 | Ga0466716_321962 | 3300042605 | Bacteria | 4896 |
| 194 | Ga0466719_104556 | 3300042606 | Bacteria | 9411 |
| 195 | Ga0466719_430060 | 3300042606 | Bacteria | 7034 |
| 196 | Ga0466719_466076 | 3300042606 | Bacteria | 15076 |
| 197 | Ga0466735_224372 | 3300042624 | Bacteria | 2365 |
| 198 | Ga0466703_077722 | 3300042636 | Bacteria | 17217 |
| 199 | Ga0466703_274401 | 3300042636 | Bacteria | 5528 |
| 200 | Ga0466709_090691 | 3300042648 | Bacteria | 38263 |
| 201 | Ga0466709_277111 | 3300042648 | Bacteria | 42015 |
| 202 | Ga0466708_406465 | 3300042652 | Bacteria | 25330 |
| 203 | Ga0466727_161799 | 3300042655 | Bacteria | 20199 |
| 204 | Ga0466727_318785 | 3300042655 | Bacteria | 4869 |
| 205 | Ga0123357_10145625 | 3300009784 | Bacteria | 2895 |
| 206 | 2227275230 | 2225789004 | Bacteria | 30389 |
| 207 | IMNBL1DRAFT_c0004896 | 3300000062 | Bacteria | 7857 |
| 208 | JGI24702J35022_10006164 | 3300002462 | Bacteria | 6952 |
| 209 | Ga0466691_007919 | 3300042593 | Bacteria | 7420 |
| 210 | Ga0466696_035475 | 3300042596 | Bacteria | 23464 |
| 211 | Ga0466696_192499 | 3300042596 | Bacteria | 34182 |
| 212 | Ga0466696_361415 | 3300042596 | Bacteria | 4063 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13155 | Toprim_2 | Toprim-like | 263 | 347 | 0.98 |
| PF13662 | Toprim_4 | Toprim domain | 262 | 336 | 0.95 |
| PF01807 | zf-CHC2 | CHC2 zinc finger | 5 | 96 | 0.95 |
| PF08275 | DNAG_N | DNA primase catalytic core, N-terminal domain | 123 | 252 | 0.92 |
| PF01751 | Toprim | Toprim domain | 263 | 333 | 0.88 |
| PF10410 | DnaB_bind | DnaB-helicase binding domain of primase | 375 | 418 | 0.88 |
| PF13362 | Toprim_3 | Toprim domain | 263 | 351 | 0.81 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF10410 | GO:0016779 | nucleotidyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.