Protein Family IF04514

Metagenome Isolate
241 Members
77 Samples
212 Scaffolds
657.71 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_172738|Ga0466690_172738_38325_40604
Length
759 aa
Sequence
MIDKYTADRIYNAAQIVDVVSDFVTLRKRGANYVGLCPFHSDNTPSFHVSPSKNICKCFACGEGGTSVQFIMKHEQISYYEALRYLAKKYNIEIRERELTDEEKHMQSDRESMVIINNWAQKFFASRLYEHEEGRRIAMSYFTERGFRDDIVRKFQLGYSLNKRDDLYANATEHGFNEIYLLKTGLVYKRDDGAIADRFHGRVIFPVHTLSGKVIAFGGRILGKKDKVAKYINSPESEIYHKSNELYGIYFARQAIVRADKCYLVEGYTDVISMHQTGIENVVASSGTSLTDGQIRLIHRFTNNITVLYDGDAAGIKAAIRGIDMLLAEGMNVKVVLLPEGEDPDSFARSHNSFDFTLYINEHEVDFIRFKAGLLLKEADDDPVKRINLIKEMMETIAVIPDNITRSVYIKECSHLFDGREQLLMDEVMKIRGRRSRSVQKMPGQRTSPPALSALSDSNLSASAQTTFAQPDSPSMIPAQSTSDVRTTPFPPASARTASDQMIWDGELATLTPNDYPPDVTTETKEGGAATGDITGKTETPVNNRDYKYSPFKKYESILLRYVIRYGERILFVDKKSDENGDIERLVSVAEYIQSELQKDEIEIQTPIYKRILEEAIVQSENEGFTASHYFLTHSDLEISKLATDMISSKYSLSKYFYNPEDVALKQTTLSDERQEAENEARKRXKERDQLERWVVHDIFTLKNAYIKHKIDDVNKQMREFRSDEEKVMTLLKKRMELDRTKIKLSKALGDRIVTGIGE

πŸ“Š Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 23.4%
Blattidae 19.5%
Kalotermitidae 18.2%
Unclassified 15.6%
Rhinotermitidae 6.5%
Armadillidiidae 5.2%
Termopsidae 3.9%
Passalidae 2.6%
Hydrophilidae 2.6%
Hodotermitidae 1.3%
Tenebrionidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
2 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
3 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 2920168565 Paludibacter sp. 221 Isolate Blattidae
14 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
19 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
20 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
21 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
22 3004672520 Bacteroides sp. 51 Isolate Blattidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
25 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
31 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
32 3004667792 Bacteroides sp. 519 Isolate Blattidae
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
40 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
53 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
54 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
55 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
56 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
57 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
58 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
59 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
60 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
61 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
62 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
63 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
64 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
65 3004677695 Bacteroides sp. 214 Isolate Blattidae
66 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
67 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
68 2922326829 Bacteroides sp. 224 Isolate Blattidae
69 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
70 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
71 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
72 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
73 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
74 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
75 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
76 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
77 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_004413 3300042612 Bacteria 6122
2 Ga0466733_110450 3300042659 Bacteria 40709
3 Ga0466715_009406 3300042616 Bacteria 67720
4 Ga0466715_117721 3300042616 Bacteria 5545
5 Ga0466715_125413 3300042616 Bacteria 7398
6 Ga0466715_265152 3300042616 Bacteria 6027
7 Ga0466715_304466 3300042616 Bacteria 8317
8 Ga0466723_047670 3300042618 Bacteria 16534
9 Ga0466701_047675 3300042598 Bacteria 4166
10 Ga0466706_081386 3300042599 Bacteria 4301
11 Ga0466706_105640 3300042599 Bacteria 39915
12 Ga0466713_038044 3300042602 Bacteria 17226
13 Ga0466713_077466 3300042602 Bacteria 18852
14 Ga0466713_082368 3300042602 Bacteria 6872
15 Ga0466714_015825 3300042603 Bacteria 102725
16 Ga0466717_072598 3300042604 Bacteria 3923
17 Ga0466716_102225 3300042605 Bacteria 13051
18 Ga0466729_253528 3300042621 Bacteria 21930
19 Ga0466735_039223 3300042624 Bacteria 15993
20 Ga0466735_093862 3300042624 Bacteria 8309
21 Ga0466735_121061 3300042624 Bacteria 3415
22 Ga0466735_194557 3300042624 Bacteria 3601
23 Ga0466730_057655 3300042625 Bacteria 4426
24 Ga0466703_314483 3300042636 Bacteria 6345
25 Ga0466703_369160 3300042636 Bacteria 28465
26 Ga0466704_254192 3300042643 Bacteria 18084
27 Ga0466709_069983 3300042648 Bacteria 5831
28 Ga0466727_108007 3300042655 Bacteria 8191
29 2227524636 2225789004 Bacteria 16862
30 IMNBL1DRAFT_c0008777 3300000062 Bacteria 5098
31 Ga0068305_10007593 3300005083 Bacteria 80483
32 Ga0068305_10016637 3300005083 Bacteria 21059
33 Ga0160469_101296 3300012824 Unclassified 7055
34 Ga0160445_100403 3300012847 Bacteria 23773
35 Ga0466690_058719 3300042590 Bacteria 19075
36 Ga0466690_172738 3300042590 Bacteria 57212
37 Ga0466690_213399 3300042590 Bacteria 31259
38 Ga0466691_091359 3300042593 Bacteria 169365
39 Ga0466710_004099 3300042613 Bacteria 12802
40 Ga0466711_040127 3300042615 Bacteria 5853
41 Ga0466711_043069 3300042615 Bacteria 11918
42 Ga0466711_347073 3300042615 Bacteria 35232
43 Ga0466728_071543 3300042620 Bacteria 7329
44 Ga0466706_053146 3300042599 Bacteria 5517
45 Ga0466706_055172 3300042599 Bacteria 72109
46 Ga0466707_010232 3300042601 Bacteria 5492
47 Ga0466707_185441 3300042601 Bacteria 8669
48 Ga0466707_192374 3300042601 Bacteria 3221
49 Ga0466713_129617 3300042602 Bacteria 20656
50 Ga0466714_155925 3300042603 Bacteria 12391
51 Ga0466719_222230 3300042606 Bacteria 4142
52 Ga0466719_475113 3300042606 Bacteria 6093
53 Ga0466721_253481 3300042608 Bacteria 27977
54 Ga0466722_113613 3300042609 Bacteria 129604
55 Ga0466729_273173 3300042621 Bacteria 5065
56 Ga0466703_199067 3300042636 Bacteria 3831
57 Ga0466709_245877 3300042648 Bacteria 9500
58 Ga0466724_57528 3300042649 Bacteria 5576
59 Ga0466727_259735 3300042655 Bacteria 15797
60 Ga0123354_10004434 3300010882 Bacteria 19900
61 JGI24702J35022_10002964 3300002462 Bacteria 10272
62 JGI24702J35022_10003669 3300002462 Bacteria 9239
63 JGI24705J35276_12224540 3300002504 Bacteria 2621
64 Ga0123357_10000662 3300009784 Bacteria 34422
65 Ga0466657_038921 3300042582 Bacteria 11436
66 Ga0466696_077461 3300042596 Bacteria 10279
67 Ga0466705_046808 3300042612 Bacteria 25523
68 Ga0466726_233725 3300042619 Bacteria 3096
69 Ga0466726_271290 3300042619 Bacteria 6858
70 Ga0466726_371181 3300042619 Bacteria 11544
71 Ga0466706_127995 3300042599 Bacteria 4829
72 Ga0466706_192891 3300042599 Bacteria 26478
73 Ga0466707_131171 3300042601 Bacteria 11165
74 Ga0466713_019827 3300042602 Bacteria 4839
75 Ga0466713_102508 3300042602 Unclassified 8446
76 Ga0466713_118123 3300042602 Bacteria 66356
77 Ga0466722_111299 3300042609 Bacteria 5447
78 Ga0466729_247937 3300042621 Bacteria 4333
79 Ga0466703_411030 3300042636 Bacteria 3837
80 Ga0466704_231510 3300042643 Bacteria 12191
81 Ga0466727_036767 3300042655 Bacteria 15833
82 Ga0466727_301207 3300042655 Bacteria 13153
83 Ga0123353_10000499 3300010167 Bacteria 48625
84 2227607943 2225789004 Bacteria 12222
85 IMNBL1DRAFT_c0000384 3300000062 Bacteria 37809
86 Ga0123357_10001146 3300009784 Bacteria 27559
87 Ga0160468_100065 3300012819 Bacteria 140978
88 Ga0466690_046586 3300042590 Bacteria 8503
89 Ga0466696_054357 3300042596 Bacteria 37826
90 Ga0466697_163544 3300042611 Bacteria 8660
91 Ga0466711_069341 3300042615 Bacteria 69315
92 Ga0466715_240118 3300042616 Bacteria 29584
93 Ga0466715_548749 3300042616 Bacteria 16600
94 Ga0466723_057399 3300042618 Bacteria 11577
95 Ga0466728_166131 3300042620 Bacteria 8079
96 Ga0466707_377635 3300042601 Bacteria 12151
97 Ga0466713_119805 3300042602 Bacteria 79435
98 Ga0466719_055757 3300042606 Bacteria 33722
99 Ga0466722_107967 3300042609 Bacteria 4831
100 Ga0466735_179643 3300042624 Bacteria 2569
101 Ga0466704_257824 3300042643 Bacteria 23792
102 Ga0466725_141888 3300042654 Bacteria 11341
103 Ga0466727_153723 3300042655 Bacteria 2939
104 Ga0123356_10066955 3300010049 Bacteria 3363
105 Ga0123353_10111532 3300010167 Bacteria 4405
106 Ga0068305_10010856 3300005083 Bacteria 14545
107 Ga0160433_100181 3300012846 Bacteria 51962
108 Ga0466696_324178 3300042596 Bacteria 4116
109 Ga0466696_475058 3300042596 Bacteria 5985
110 Ga0466732_007018 3300042656 Bacteria 6125
111 Ga0466715_090798 3300042616 Bacteria 3502
112 Ga0466723_367142 3300042618 Bacteria 7612
113 Ga0466706_053989 3300042599 Bacteria 17416
114 Ga0466706_140857 3300042599 Bacteria 123527
115 Ga0466707_361813 3300042601 Bacteria 12501
116 Ga0466713_058807 3300042602 Bacteria 13735
117 Ga0466716_086550 3300042605 Bacteria 19403
118 Ga0466722_080343 3300042609 Bacteria 16839
119 Ga0466697_011496 3300042611 Bacteria 51969
120 Ga0466735_083854 3300042624 Bacteria 2862
121 Ga0466709_140267 3300042648 Bacteria 28990
122 Ga0123357_10126919 3300009784 Bacteria 3192
123 Ga0123353_10061083 3300010167 Bacteria 6043
124 Ga0123354_10002434 3300010882 Bacteria 24588
125 IMNBL1DRAFT_c0010391 3300000062 Bacteria 4463
126 IMNBL1DRAFT_c0016795 3300000062 Bacteria 3114
127 Ga0466690_208472 3300042590 Bacteria 11925
128 Ga0466690_402774 3300042590 Bacteria 11069
129 Ga0466691_022383 3300042593 Bacteria 23421
130 Ga0466696_181576 3300042596 Bacteria 6528
131 Ga0466733_064266 3300042659 Bacteria 6283
132 Ga0466710_165584 3300042613 Unclassified 7014
133 Ga0466715_307197 3300042616 Bacteria 27739
134 Ga0466715_321517 3300042616 Bacteria 3743
135 Ga0466715_458520 3300042616 Bacteria 8601
136 Ga0466723_190749 3300042618 Bacteria 41750
137 Ga0466728_257466 3300042620 Bacteria 6677
138 Ga0466707_188687 3300042601 Bacteria 10744
139 Ga0466714_006756 3300042603 Bacteria 211810
140 Ga0466719_015462 3300042606 Bacteria 9666
141 Ga0466703_075647 3300042636 Bacteria 21491
142 Ga0466703_383067 3300042636 Bacteria 2847
143 Ga0466709_027878 3300042648 Bacteria 5136
144 Ga0466708_044096 3300042652 Bacteria 70438
145 Ga0466708_292277 3300042652 Bacteria 30652
146 Ga0123357_10006139 3300009784 Bacteria 14562
147 IMNBL1DRAFT_c0002685 3300000062 Bacteria 12147
148 JGI24702J35022_10026185 3300002462 Bacteria 3143
149 JGI24705J35276_12238303 3300002504 Bacteria 18959
150 Ga0466690_042304 3300042590 Bacteria 9883
151 Ga0466691_006250 3300042593 Bacteria 8667
152 Ga0466696_160607 3300042596 Bacteria 11793
153 Ga0466705_358603 3300042612 Bacteria 26821
154 Ga0466733_032742 3300042659 Unclassified 6534
155 Ga0466733_098295 3300042659 Bacteria 47070
156 Ga0466733_181390 3300042659 Bacteria 5500
157 Ga0562377_0004 3300056842 Bacteria 3525959
158 Ga0466715_028764 3300042616 Bacteria 6954
159 Ga0466715_222450 3300042616 Bacteria 11588
160 Ga0466715_542695 3300042616 Bacteria 15092
161 Ga0466728_057042 3300042620 Bacteria 28719
162 Ga0466728_234918 3300042620 Bacteria 4366
163 Ga0466728_333993 3300042620 Bacteria 5579
164 Ga0466706_023757 3300042599 Bacteria 27793
165 Ga0466713_060328 3300042602 Bacteria 119085
166 Ga0466719_450712 3300042606 Bacteria 11900
167 Ga0466722_021127 3300042609 Bacteria 2767
168 Ga0466722_068382 3300042609 Bacteria 3054
169 Ga0466722_088281 3300042609 Bacteria 7425
170 Ga0466735_013877 3300042624 Bacteria 4258
171 Ga0466703_335341 3300042636 Bacteria 10091
172 Ga0466704_065433 3300042643 Bacteria 13281
173 Ga0466704_153119 3300042643 Bacteria 6789
174 Ga0466704_343809 3300042643 Bacteria 5884
175 Ga0466708_061761 3300042652 Bacteria 24390
176 Ga0123353_10073987 3300010167 Bacteria 5477
177 2227444694 2225789004 Bacteria 5467
178 Ga0160445_100097 3300012847 Bacteria 88551
179 Ga0466690_238245 3300042590 Bacteria 6928
180 Ga0466691_034693 3300042593 Bacteria 6170
181 Ga0466691_035670 3300042593 Bacteria 11664
182 Ga0466691_058338 3300042593 Bacteria 8322
183 Ga0466691_081545 3300042593 Bacteria 5632
184 Ga0466696_201817 3300042596 Bacteria 41274
185 Ga0466733_070989 3300042659 Bacteria 25252
186 Ga0466733_211287 3300042659 Bacteria 6139
187 Ga0466705_490256 3300042612 Bacteria 7493
188 Ga0466715_153096 3300042616 Bacteria 36493
189 Ga0466723_013868 3300042618 Bacteria 21533
190 Ga0466723_202271 3300042618 Bacteria 31309
191 Ga0466728_174203 3300042620 Bacteria 15013
192 Ga0466706_082742 3300042599 Bacteria 3481
193 Ga0466716_321962 3300042605 Bacteria 4896
194 Ga0466719_104556 3300042606 Bacteria 9411
195 Ga0466719_430060 3300042606 Bacteria 7034
196 Ga0466719_466076 3300042606 Bacteria 15076
197 Ga0466735_224372 3300042624 Bacteria 2365
198 Ga0466703_077722 3300042636 Bacteria 17217
199 Ga0466703_274401 3300042636 Bacteria 5528
200 Ga0466709_090691 3300042648 Bacteria 38263
201 Ga0466709_277111 3300042648 Bacteria 42015
202 Ga0466708_406465 3300042652 Bacteria 25330
203 Ga0466727_161799 3300042655 Bacteria 20199
204 Ga0466727_318785 3300042655 Bacteria 4869
205 Ga0123357_10145625 3300009784 Bacteria 2895
206 2227275230 2225789004 Bacteria 30389
207 IMNBL1DRAFT_c0004896 3300000062 Bacteria 7857
208 JGI24702J35022_10006164 3300002462 Bacteria 6952
209 Ga0466691_007919 3300042593 Bacteria 7420
210 Ga0466696_035475 3300042596 Bacteria 23464
211 Ga0466696_192499 3300042596 Bacteria 34182
212 Ga0466696_361415 3300042596 Bacteria 4063

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13155 Toprim_2 Toprim-like 263 347 0.98
PF13662 Toprim_4 Toprim domain 262 336 0.95
PF01807 zf-CHC2 CHC2 zinc finger 5 96 0.95
PF08275 DNAG_N DNA primase catalytic core, N-terminal domain 123 252 0.92
PF01751 Toprim Toprim domain 263 333 0.88
PF10410 DnaB_bind DnaB-helicase binding domain of primase 375 418 0.88
PF13362 Toprim_3 Toprim domain 263 351 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF10410 GO:0016779 nucleotidyltransferase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.