Protein Family IF04481

Metagenome Isolate
189 Members
63 Samples
176 Scaffolds
476.93 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_070518|Ga0466690_070518_6069_7727
Length
525 aa
Sequence
MEILPTLLYNKTDLEAMTVWFTFWEQYIPRTADFNKERALVRRDFPKIHFYDQDFVDIYDKTWVWIQDCWSTGSDKIAAGEGVKENAANEIIEGKFFSYPGSPVIHQADAVYSSFFLVYSNRIYHAHPSLDVFYSHQEPNGAIRSAYNIKTGLPELAPDNPDGLALPLFSWAEFNLYHKTANKKRIKEVIPILHKYIAWLDEFKRPNGLYEVPVAATGMATPVREGAAYPVDFNTVMAINVLYMSALADILNDKEASFQYKRQYFSLKTRINRLMWNNDDGFYYDIDKYEKQIKVKTLAGYWSLLAEIPNDDKAERIIGKLSDPAFFGSPHPFPSMAMNESAFSELGCGFNGSVYPHLTFMVIKGLERYQRWDFARECATRHLYFVLDSMSPDGNHHKGNLWEAYLPLKEGPAQWPGAADFPRSQYLTYAALSTVCLTIENVIGLLISLPRKTVDWIIPNLEIMGIENLSLKKNLITILSNKSGRGWEIHMESEKLYYFTINILGKKKKTLPIPSGKCSMLIDKL

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.3%
Unclassified 26.2%
Kalotermitidae 23.0%
Rhinotermitidae 4.9%
Termopsidae 4.9%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
5 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
36 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
41 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
49 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
57 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
58 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_362077 3300042590 Bacteria 1935
2 Ga0466692_164656 3300042591 Bacteria 21408
3 Ga0466693_186633 3300042592 Bacteria 79738
4 Ga0466694_202435 3300042594 Bacteria 20367
5 Ga0466694_285787 3300042594 Bacteria 38692
6 Ga0466696_152232 3300042596 Bacteria 14945
7 Ga0466696_425714 3300042596 Bacteria 23033
8 Ga0123356_10000249 3300010049 Bacteria 61743
9 Ga0466705_474726 3300042612 Bacteria 17919
10 Ga0466705_498405 3300042612 Bacteria 10957
11 Ga0466712_043753 3300042614 Bacteria 23887
12 Ga0466712_091209 3300042614 Bacteria 5532
13 Ga0466711_206135 3300042615 Bacteria 18008
14 Ga0466715_378692 3300042616 Bacteria 17596
15 Ga0466723_214354 3300042618 Bacteria 13654
16 Ga0466728_447202 3300042620 Bacteria 2755
17 Ga0466706_213807 3300042599 Bacteria 5697
18 Ga0466707_219043 3300042601 Bacteria 1651
19 Ga0466702_076095 3300042635 Bacteria 4297
20 Ga0466702_192458 3300042635 Bacteria 4538
21 Ga0466703_185697 3300042636 Bacteria 25709
22 Ga0466704_250209 3300042643 Bacteria 34988
23 Ga0466704_366916 3300042643 Bacteria 18576
24 Ga0466709_168442 3300042648 Bacteria 10545
25 Ga0466690_311276 3300042590 Bacteria 1739
26 Ga0466691_004238 3300042593 Bacteria 8228
27 Ga0466691_092029 3300042593 Bacteria 20238
28 Ga0466694_077602 3300042594 Bacteria 6915
29 Ga0466696_055581 3300042596 Bacteria 7451
30 Ga0466696_118077 3300042596 Bacteria 22110
31 Ga0466696_157049 3300042596 Bacteria 12816
32 Ga0466699_427243 3300042597 Bacteria 5317
33 Ga0123357_10013553 3300009784 Bacteria 10589
34 Ga0466712_042735 3300042614 Bacteria 35616
35 Ga0466712_222412 3300042614 Bacteria 15716
36 Ga0466715_138077 3300042616 Bacteria 28303
37 Ga0466715_227761 3300042616 Bacteria 2656
38 Ga0466723_206929 3300042618 Bacteria 10759
39 Ga0466723_347057 3300042618 Bacteria 8186
40 Ga0466726_102063 3300042619 Bacteria 17888
41 Ga0466726_301744 3300042619 Bacteria 4530
42 Ga0466716_130134 3300042605 Bacteria 8491
43 Ga0466716_461987 3300042605 Bacteria 2057
44 JGI24698J34947_10000404 3300002449 Bacteria 19671
45 JGI24698J34947_10017301 3300002449 Bacteria 3908
46 JGI24695J34938_10000529 3300002450 Bacteria 37004
47 JGI24702J35022_10015480 3300002462 Bacteria 4197
48 Ga0466703_084842 3300042636 Bacteria 9634
49 Ga0466703_199706 3300042636 Bacteria 15629
50 Ga0466704_111372 3300042643 Bacteria 52956
51 Ga0466704_206805 3300042643 Bacteria 7007
52 Ga0466727_075111 3300042655 Bacteria 4242
53 Ga0466727_336564 3300042655 Bacteria 5029
54 Ga0466691_205051 3300042593 Bacteria 12654
55 Ga0466695_221990 3300042595 Bacteria 77793
56 Ga0123353_10119497 3300010167 Bacteria 4239
57 Ga0466712_038554 3300042614 Bacteria 8844
58 Ga0466711_086153 3300042615 Bacteria 9171
59 Ga0466723_041794 3300042618 Bacteria 2136
60 Ga0466726_433141 3300042619 Bacteria 11551
61 Ga0466729_164583 3300042621 Bacteria 1929
62 Ga0466706_126354 3300042599 Bacteria 11523
63 Ga0466717_188143 3300042604 Bacteria 1963
64 Ga0466698_075992 3300042610 Bacteria 12007
65 JGI24698J34947_10010517 3300002449 Unclassified 5078
66 Ga0466704_477135 3300042643 Bacteria 8956
67 Ga0466708_066838 3300042652 Bacteria 32818
68 Ga0466705_013264 3300042612 Bacteria 16338
69 Ga0466705_014464 3300042612 Bacteria 3982
70 Ga0264413_104689 3300024493 Bacteria 4814
71 Ga0466690_000984 3300042590 Bacteria 53852
72 Ga0466692_149322 3300042591 Bacteria 5650
73 Ga0466694_005840 3300042594 Bacteria 106514
74 Ga0123356_10005024 3300010049 Bacteria 13561
75 Ga0466715_085574 3300042616 Bacteria 8926
76 Ga0466715_308927 3300042616 Bacteria 17155
77 Ga0466723_289822 3300042618 Unclassified 4550
78 Ga0466726_034060 3300042619 Bacteria 15500
79 Ga0466728_301164 3300042620 Bacteria 3611
80 Ga0466707_386180 3300042601 Bacteria 3684
81 Ga0466713_143614 3300042602 Bacteria 2026
82 JGI24698J34947_10016497 3300002449 Bacteria 4009
83 JGI24695J34938_10000876 3300002450 Bacteria 27795
84 Ga0466731_207283 3300042622 Bacteria 10763
85 Ga0466702_364223 3300042635 Unclassified 2672
86 Ga0466703_061549 3300042636 Bacteria 5412
87 Ga0466703_080701 3300042636 Bacteria 18954
88 Ga0466704_357597 3300042643 Bacteria 27543
89 Ga0466709_008898 3300042648 Unclassified 5199
90 Ga0466709_027268 3300042648 Bacteria 4593
91 Ga0466708_159290 3300042652 Bacteria 3855
92 Ga0466708_328366 3300042652 Unclassified 8295
93 Ga0466705_024137 3300042612 Unclassified 9349
94 Ga0466705_059722 3300042612 Bacteria 11103
95 Ga0466705_199987 3300042612 Bacteria 3911
96 Ga0466692_120629 3300042591 Bacteria 11031
97 Ga0466692_200660 3300042591 Bacteria 2783
98 Ga0466692_203028 3300042591 Bacteria 6227
99 Ga0466691_033739 3300042593 Bacteria 7786
100 Ga0466691_063934 3300042593 Bacteria 11155
101 Ga0466696_434397 3300042596 Bacteria 9417
102 Ga0466712_033366 3300042614 Bacteria 28713
103 Ga0466715_093039 3300042616 Bacteria 4641
104 Ga0466726_394529 3300042619 Bacteria 6194
105 Ga0466722_194617 3300042609 Bacteria 10053
106 AustNasuHG_c1016198 3300000089 Bacteria 2499
107 Ga0466735_102914 3300042624 Bacteria 3805
108 Ga0466702_402965 3300042635 Bacteria 1605
109 Ga0466703_269294 3300042636 Bacteria 25548
110 Ga0466704_032239 3300042643 Bacteria 21487
111 Ga0466704_411953 3300042643 Bacteria 1993
112 Ga0466709_058054 3300042648 Bacteria 9911
113 Ga0466708_308305 3300042652 Bacteria 6973
114 Ga0466705_106816 3300042612 Bacteria 8937
115 Ga0415639_005098 3300038395 Bacteria 21971
116 Ga0466690_163825 3300042590 Unclassified 2973
117 Ga0466690_312592 3300042590 Bacteria 5875
118 Ga0466691_155881 3300042593 Bacteria 7179
119 Ga0466712_066846 3300042614 Bacteria 4970
120 Ga0466711_030550 3300042615 Bacteria 19572
121 Ga0466715_252950 3300042616 Bacteria 3135
122 Ga0466723_193287 3300042618 Unclassified 1858
123 Ga0466726_126274 3300042619 Bacteria 7652
124 Ga0466720_234824 3300042607 Unclassified 3334
125 Ga0466722_072167 3300042609 Bacteria 4590
126 JGI24695J34938_10004610 3300002450 Bacteria 8963
127 Ga0466702_039700 3300042635 Bacteria 15948
128 Ga0466702_061677 3300042635 Bacteria 3096
129 Ga0466703_086333 3300042636 Bacteria 22187
130 Ga0466704_152278 3300042643 Bacteria 2148
131 Ga0466708_041552 3300042652 Bacteria 9503
132 Ga0466708_334476 3300042652 Bacteria 13690
133 Ga0466708_424368 3300042652 Unclassified 5442
134 Ga0466732_355699 3300042656 Unclassified 1977
135 Ga0466690_307022 3300042590 Bacteria 5406
136 Ga0466691_092461 3300042593 Bacteria 19341
137 Ga0466694_331591 3300042594 Bacteria 1888
138 Ga0123355_10017180 3300009826 Bacteria 11423
139 Ga0123353_10003165 3300010167 Bacteria 20693
140 Ga0123354_10124759 3300010882 Bacteria 3297
141 Ga0466712_043323 3300042614 Bacteria 3350
142 Ga0466711_170233 3300042615 Bacteria 2876
143 Ga0466723_096576 3300042618 Bacteria 15241
144 Ga0466723_150577 3300042618 Unclassified 6574
145 Ga0466726_301853 3300042619 Bacteria 9267
146 Ga0466726_380186 3300042619 Bacteria 5437
147 Ga0466706_030503 3300042599 Bacteria 7425
148 Ga0466714_042127 3300042603 Bacteria 1797
149 Ga0466716_140743 3300042605 Bacteria 26918
150 Ga0466719_200254 3300042606 Bacteria 1385
151 Ga0466722_011447 3300042609 Bacteria 2225
152 JGI24698J34947_10017490 3300002449 Unclassified 3884
153 JGI24695J34938_10011520 3300002450 Unclassified 4758
154 Ga0068305_10013973 3300005083 Bacteria 11658
155 Ga0072940_1022677 3300005200 Bacteria 29727
156 Ga0072941_1007748 3300005201 Bacteria 28364
157 Ga0466705_216160 3300042612 Bacteria 2217
158 Ga0466733_160991 3300042659 Bacteria 8322
159 Ga0264413_104575 3300024493 Bacteria 9076
160 Ga0466690_070518 3300042590 Bacteria 13128
161 Ga0123356_10000246 3300010049 Bacteria 62303
162 Ga0466715_291797 3300042616 Bacteria 40545
163 Ga0466723_037529 3300042618 Bacteria 5102
164 Ga0466723_242371 3300042618 Bacteria 31023
165 Ga0466726_010172 3300042619 Bacteria 12413
166 Ga0466728_150806 3300042620 Bacteria 21274
167 Ga0466728_247552 3300042620 Bacteria 4861
168 Ga0466716_181555 3300042605 Bacteria 7477
169 AustNasuHG_c1003491 3300000089 Bacteria 5679
170 JGI24698J34947_10013237 3300002449 Unclassified 4507
171 JGI24698J34947_10058097 3300002449 Bacteria 1917
172 Ga0072941_1016875 3300005201 Bacteria 4627
173 Ga0466731_087164 3300042622 Bacteria 10910
174 Ga0466703_038302 3300042636 Bacteria 14635
175 Ga0466704_433789 3300042643 Bacteria 54851
176 Ga0466727_266785 3300042655 Bacteria 5787

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22422 MGH1-like_GH Mannosylglycerate hydrolase MGH1-like glycoside hydrolase domain 167 410 0.8
PF01204 Trehalase Trehalase 227 391 0.76

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.