Protein Family IF04462
Metagenome
Isolate
260
Members
123
Samples
211
Scaffolds
282.31
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_029026|Ga0466690_029026_1685_2608
- Length
- 307 aa
- Sequence
- MPITLKTEKSKKPLWFKYMQKKETIILPLIQQAIKEDVGDGDHTSLATVPPSATGKAVLIAKEDGIIAGMEIAELVYKTIDPNTIFTTLKQDGDKINIGDKIFEVEGLSRSILTAERLSLNYIQRMSGIATHTRRLVQAIKAAGSTTTLLDTRKTTPNNRIFEKIAVRIGGGSNHRFGLFDMILIKDNHIDFAGGTVKALDKVKDYLSNTDKQLKVEIEVRTMQELQEVMEWGERNPNGLHRIMLDNFTPDTLTQALSIIAKKYETEASGGITEKNLFDYAVTNVDFISIGALTHHIKALDLSLRAI
Sample Types
Isolate
18.9%
Metagenome
81.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.6%
Unclassified
15.8%
Blattidae
9.6%
Kalotermitidae
8.8%
Culicidae
7.0%
Elmidae
6.1%
Armadillidiidae
6.1%
Formicidae
4.4%
Drosophilidae
4.4%
Rhinotermitidae
3.5%
Passalidae
2.6%
Hydrophilidae
2.6%
Apidae
0.9%
Bombycidae
0.9%
Cambaridae
0.9%
Termopsidae
0.9%
Hodotermitidae
0.9%
Taxonomy
Archaea
2
Bacteria
248
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 3 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 4 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 5 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 6 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 7 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 8 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 9 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 10 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 11 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 12 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 13 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 14 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 15 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 18 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 19 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 20 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 27 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 28 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 35 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 42 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 45 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 46 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 47 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 48 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 49 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 52 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 53 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 58 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 59 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 60 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 61 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 62 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 63 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 65 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 66 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 67 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 71 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 72 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 73 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 74 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 75 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 76 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 80 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 81 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 82 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 83 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 84 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 85 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 86 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 87 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 88 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 89 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 90 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 91 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 92 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 93 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 94 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 95 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 96 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 97 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 98 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 99 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 100 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 101 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 102 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 103 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 104 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 105 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 106 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 107 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 108 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 109 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 110 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 111 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 112 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 113 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 114 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 115 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 116 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 117 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 118 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 119 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 120 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 121 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 122 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 123 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_190275 | 3300042659 | Bacteria | 18255 |
| 2 | Ga0160444_100029 | 3300012841 | Bacteria | 247585 |
| 3 | Ga0160460_100143 | 3300012845 | Bacteria | 83893 |
| 4 | Ga0160445_104510 | 3300012847 | Bacteria | 2532 |
| 5 | Ga0466693_436802 | 3300042592 | Bacteria | 1608 |
| 6 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 7 | Ga0466707_294513 | 3300042601 | Bacteria | 4199 |
| 8 | Ga0123356_10058160 | 3300010049 | Bacteria | 3604 |
| 9 | Ga0123353_10065867 | 3300010167 | Bacteria | 5815 |
| 10 | Ga0123353_10430393 | 3300010167 | Bacteria | 1952 |
| 11 | Ga0068305_10020582 | 3300005083 | Bacteria | 3855 |
| 12 | Ga0072941_1009394 | 3300005201 | Bacteria | 20302 |
| 13 | Ga0104045_1026893 | 3300007085 | Bacteria | 4431 |
| 14 | Ga0466731_074143 | 3300042622 | Bacteria | 2038 |
| 15 | Ga0466731_177490 | 3300042622 | Bacteria | 1014 |
| 16 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 17 | Ga0466724_15059 | 3300042649 | Bacteria | 177995 |
| 18 | Ga0466708_258317 | 3300042652 | Bacteria | 16448 |
| 19 | Ga0466725_418412 | 3300042654 | Bacteria | 2245 |
| 20 | Ga0466697_147611 | 3300042611 | Bacteria | 1197 |
| 21 | Ga0466697_263655 | 3300042611 | Bacteria | 3091 |
| 22 | Ga0466732_074167 | 3300042656 | Bacteria | 5574 |
| 23 | Ga0466733_011761 | 3300042659 | Bacteria | 10355 |
| 24 | Ga0466733_086916 | 3300042659 | Bacteria | 33239 |
| 25 | Ga0160445_100306 | 3300012847 | Bacteria | 29921 |
| 26 | Ga0466694_054754 | 3300042594 | Bacteria | 5629 |
| 27 | Ga0466694_350267 | 3300042594 | Bacteria | 2430 |
| 28 | Ga0466701_002527 | 3300042598 | Bacteria | 2385 |
| 29 | Ga0466701_094761 | 3300042598 | Bacteria | 3216 |
| 30 | Ga0466707_046613 | 3300042601 | Bacteria | 14993 |
| 31 | Ga0123353_10016069 | 3300010167 | Unclassified | 10919 |
| 32 | Ga0123353_10085475 | 3300010167 | Bacteria | 5080 |
| 33 | Ga0123353_10226444 | 3300010167 | Bacteria | 2919 |
| 34 | Ga0123354_10282146 | 3300010882 | Bacteria | 1610 |
| 35 | JGI24696J40584_12958847 | 3300002834 | Bacteria | 4458 |
| 36 | Ga0104045_1001565 | 3300007085 | Unclassified | 15348 |
| 37 | Ga0104045_1002543 | 3300007085 | Unclassified | 3936 |
| 38 | Ga0104044_1147053 | 3300007136 | Bacteria | 1694 |
| 39 | Ga0102740_1000269 | 3300007140 | Bacteria | 14847 |
| 40 | Ga0466731_094301 | 3300042622 | Bacteria | 71133 |
| 41 | Ga0466725_468532 | 3300042654 | Bacteria | 24336 |
| 42 | Ga0466697_198816 | 3300042611 | Bacteria | 6438 |
| 43 | Ga0466733_100388 | 3300042659 | Bacteria | 2444 |
| 44 | Ga0160469_100004 | 3300012824 | Bacteria | 821419 |
| 45 | Ga0160433_100070 | 3300012846 | Bacteria | 109420 |
| 46 | Ga0415639_167007 | 3300038395 | Bacteria | 1419 |
| 47 | Ga0466657_205802 | 3300042582 | Bacteria | 1115 |
| 48 | Ga0466694_020558 | 3300042594 | Bacteria | 4372 |
| 49 | Ga0466699_333367 | 3300042597 | Bacteria | 3165 |
| 50 | Ga0466701_096918 | 3300042598 | Bacteria | 4268 |
| 51 | Ga0123356_10056391 | 3300010049 | Bacteria | 3660 |
| 52 | Ga0123353_10006525 | 3300010167 | Bacteria | 15543 |
| 53 | Ga0123354_10043680 | 3300010882 | Bacteria | 6887 |
| 54 | Ga0123354_10094237 | 3300010882 | Bacteria | 4109 |
| 55 | Ga0160465_100001 | 3300012803 | Bacteria | 1272344 |
| 56 | JGI24698J34947_10000002 | 3300002449 | Bacteria | 63077 |
| 57 | JGI24702J35022_10002983 | 3300002462 | Bacteria | 10240 |
| 58 | Ga0104045_1000842 | 3300007085 | Bacteria | 4552 |
| 59 | Ga0104045_1021608 | 3300007085 | Unclassified | 3148 |
| 60 | Ga0104050_1002706 | 3300007153 | Bacteria | 12919 |
| 61 | Ga0103267_1000139 | 3300007190 | Bacteria | 28036 |
| 62 | Ga0466711_161125 | 3300042615 | Bacteria | 26115 |
| 63 | Ga0466715_006373 | 3300042616 | Bacteria | 1039 |
| 64 | Ga0466715_371151 | 3300042616 | Bacteria | 3487 |
| 65 | Ga0466729_279884 | 3300042621 | Bacteria | 1222 |
| 66 | Ga0466724_27141 | 3300042649 | Bacteria | 99591 |
| 67 | Ga0466724_46079 | 3300042649 | Unclassified | 1535 |
| 68 | Ga0466697_086013 | 3300042611 | Bacteria | 1796 |
| 69 | Ga0466733_016633 | 3300042659 | Unclassified | 2374 |
| 70 | Ga0466733_026633 | 3300042659 | Bacteria | 6487 |
| 71 | Ga0466733_089283 | 3300042659 | Bacteria | 3501 |
| 72 | Ga0160467_100009 | 3300012829 | Bacteria | 588364 |
| 73 | Ga0466657_069590 | 3300042582 | Bacteria | 9666 |
| 74 | Ga0466690_029026 | 3300042590 | Bacteria | 3876 |
| 75 | Ga0466694_143721 | 3300042594 | Bacteria | 11514 |
| 76 | Ga0466699_384252 | 3300042597 | Bacteria | 1051 |
| 77 | Ga0466701_042299 | 3300042598 | Bacteria | 109601 |
| 78 | Ga0466701_078972 | 3300042598 | Bacteria | 7598 |
| 79 | Ga0466713_108729 | 3300042602 | Bacteria | 22130 |
| 80 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 81 | Ga0466717_179067 | 3300042604 | Bacteria | 4270 |
| 82 | Ga0466720_184095 | 3300042607 | Bacteria | 5051 |
| 83 | Ga0466698_397284 | 3300042610 | Bacteria | 2121 |
| 84 | Ga0123356_10059336 | 3300010049 | Bacteria | 3568 |
| 85 | Ga0123356_10618207 | 3300010049 | Bacteria | 1249 |
| 86 | Ga0123353_10000322 | 3300010167 | Bacteria | 59157 |
| 87 | Ga0123353_10001070 | 3300010167 | Bacteria | 33391 |
| 88 | Ga0123353_10248200 | 3300010167 | Bacteria | 2759 |
| 89 | Ga0123354_10127347 | 3300010882 | Unclassified | 3242 |
| 90 | 2227283305 | 2225789004 | Bacteria | 1255 |
| 91 | IMNBL1DRAFT_c0002383 | 3300000062 | Archaea | 13110 |
| 92 | Meta3P_1007996 | 3300002464 | Bacteria | 10316 |
| 93 | Ga0072941_1055252 | 3300005201 | Bacteria | 6888 |
| 94 | Ga0102735_1004895 | 3300007080 | Bacteria | 1743 |
| 95 | Ga0466703_211598 | 3300042636 | Bacteria | 1127 |
| 96 | Ga0466733_001613 | 3300042659 | Bacteria | 4379 |
| 97 | Ga0466733_142737 | 3300042659 | Bacteria | 6802 |
| 98 | Ga0160469_102019 | 3300012824 | Bacteria | 4338 |
| 99 | Ga0160455_100055 | 3300012837 | Bacteria | 213023 |
| 100 | Ga0160435_1000135 | 3300012857 | Bacteria | 41686 |
| 101 | Ga0264413_163997 | 3300024493 | Bacteria | 1674 |
| 102 | Ga0415639_104191 | 3300038395 | Bacteria | 5578 |
| 103 | Ga0466696_046109 | 3300042596 | Bacteria | 2788 |
| 104 | Ga0466696_289023 | 3300042596 | Bacteria | 1182 |
| 105 | Ga0466701_054311 | 3300042598 | Bacteria | 18356 |
| 106 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 107 | Ga0123353_10185858 | 3300010167 | Bacteria | 3286 |
| 108 | Ga0123353_10539107 | 3300010167 | Bacteria | 1687 |
| 109 | Ga0123353_10563101 | 3300010167 | Bacteria | 1640 |
| 110 | Ga0123353_10813494 | 3300010167 | Bacteria | 1288 |
| 111 | Ga0123354_10050476 | 3300010882 | Bacteria | 6296 |
| 112 | IMNBGM34_c008522 | 3300000036 | Bacteria | 1306 |
| 113 | JGI24696J40584_12947823 | 3300002834 | Bacteria | 1969 |
| 114 | Ga0068305_10013345 | 3300005083 | Bacteria | 7668 |
| 115 | Ga0103263_102565 | 3300007042 | Bacteria | 2232 |
| 116 | Ga0466710_327916 | 3300042613 | Bacteria | 1121 |
| 117 | Ga0466734_021384 | 3300042623 | Bacteria | 1322 |
| 118 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 119 | Ga0466724_45728 | 3300042649 | Bacteria | 1535 |
| 120 | Ga0466697_150941 | 3300042611 | Bacteria | 3041 |
| 121 | Ga0466697_172728 | 3300042611 | Bacteria | 1665 |
| 122 | Ga0466705_094399 | 3300042612 | Bacteria | 7676 |
| 123 | Ga0466733_192657 | 3300042659 | Bacteria | 34397 |
| 124 | Ga0466694_146004 | 3300042594 | Bacteria | 1333 |
| 125 | Ga0466699_222657 | 3300042597 | Bacteria | 2609 |
| 126 | Ga0466717_105383 | 3300042604 | Bacteria | 1755 |
| 127 | Ga0466722_100415 | 3300042609 | Bacteria | 54988 |
| 128 | Ga0466698_419024 | 3300042610 | Bacteria | 2200 |
| 129 | Ga0123356_10017284 | 3300010049 | Bacteria | 6863 |
| 130 | Ga0123356_10571047 | 3300010049 | Bacteria | 1294 |
| 131 | IMNBL1DRAFT_c0008335 | 3300000062 | Bacteria | 5288 |
| 132 | JGI24702J35022_10024405 | 3300002462 | Bacteria | 3267 |
| 133 | JGI24702J35022_10055662 | 3300002462 | Bacteria | 2110 |
| 134 | CVPL010W_10000551 | 3300002931 | Bacteria | 41299 |
| 135 | Ga0072941_1102724 | 3300005201 | Bacteria | 5523 |
| 136 | Ga0072941_1125528 | 3300005201 | Bacteria | 5922 |
| 137 | Ga0072941_1284944 | 3300005201 | Bacteria | 1073 |
| 138 | Ga0074308_1113483 | 3300005307 | Unclassified | 4252 |
| 139 | Ga0466710_136174 | 3300042613 | Bacteria | 1975 |
| 140 | Ga0466711_015059 | 3300042615 | Bacteria | 20932 |
| 141 | Ga0466711_071000 | 3300042615 | Bacteria | 20492 |
| 142 | Ga0466711_085408 | 3300042615 | Bacteria | 2257 |
| 143 | Ga0466715_072980 | 3300042616 | Bacteria | 25920 |
| 144 | Ga0466731_225663 | 3300042622 | Bacteria | 2568 |
| 145 | Ga0466731_267463 | 3300042622 | Bacteria | 2079 |
| 146 | Ga0466734_104250 | 3300042623 | Bacteria | 2471 |
| 147 | Ga0466704_342574 | 3300042643 | Bacteria | 12922 |
| 148 | Ga0466704_385915 | 3300042643 | Bacteria | 6076 |
| 149 | Ga0466724_06117 | 3300042649 | Bacteria | 3195 |
| 150 | Ga0466724_26498 | 3300042649 | Bacteria | 2470 |
| 151 | Ga0466705_236421 | 3300042612 | Bacteria | 6903 |
| 152 | Ga0160453_100066 | 3300012814 | Bacteria | 109955 |
| 153 | Ga0160443_100107 | 3300012848 | Bacteria | 133372 |
| 154 | Ga0466657_098945 | 3300042582 | Bacteria | 51985 |
| 155 | Ga0466706_003908 | 3300042599 | Bacteria | 8357 |
| 156 | Ga0466706_179014 | 3300042599 | Bacteria | 61419 |
| 157 | Ga0466713_031284 | 3300042602 | Bacteria | 27459 |
| 158 | Ga0466713_061522 | 3300042602 | Bacteria | 1382 |
| 159 | Ga0466717_275986 | 3300042604 | Bacteria | 2793 |
| 160 | Ga0466697_004063 | 3300042611 | Bacteria | 1082 |
| 161 | Ga0123356_10531293 | 3300010049 | Bacteria | 1335 |
| 162 | Ga0123354_10065832 | 3300010882 | Bacteria | 5299 |
| 163 | Ga0123354_10248142 | 3300010882 | Bacteria | 1811 |
| 164 | 2227358564 | 2225789004 | Archaea | 105107 |
| 165 | JGI24695J34938_10001881 | 3300002450 | Bacteria | 17043 |
| 166 | JGI24702J35022_10107039 | 3300002462 | Bacteria | 1535 |
| 167 | Ga0072941_1068282 | 3300005201 | Bacteria | 2289 |
| 168 | Ga0072941_1068283 | 3300005201 | Bacteria | 1893 |
| 169 | Ga0104041_1117793 | 3300007106 | Bacteria | 1177 |
| 170 | Ga0466705_525647 | 3300042612 | Bacteria | 11880 |
| 171 | Ga0466710_002073 | 3300042613 | Bacteria | 7871 |
| 172 | Ga0466718_125680 | 3300042617 | Bacteria | 60948 |
| 173 | Ga0466703_297708 | 3300042636 | Unclassified | 1201 |
| 174 | Ga0466704_595083 | 3300042643 | Bacteria | 15728 |
| 175 | Ga0466709_118766 | 3300042648 | Bacteria | 93673 |
| 176 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 177 | Ga0466724_64631 | 3300042649 | Bacteria | 10931 |
| 178 | Ga0466697_098635 | 3300042611 | Bacteria | 1652 |
| 179 | Ga0466697_263044 | 3300042611 | Bacteria | 1026 |
| 180 | Ga0466733_161831 | 3300042659 | Bacteria | 17278 |
| 181 | Ga0160453_100015 | 3300012814 | Bacteria | 282454 |
| 182 | Ga0160472_100451 | 3300012839 | Bacteria | 29353 |
| 183 | Ga0160445_104961 | 3300012847 | Bacteria | 2343 |
| 184 | Ga0415639_004919 | 3300038395 | Bacteria | 12883 |
| 185 | Ga0415639_043194 | 3300038395 | Bacteria | 10231 |
| 186 | Ga0415639_186388 | 3300038395 | Bacteria | 1219 |
| 187 | Ga0415639_218150 | 3300038395 | Bacteria | 1631 |
| 188 | Ga0466691_158142 | 3300042593 | Bacteria | 8927 |
| 189 | Ga0466701_000848 | 3300042598 | Bacteria | 17703 |
| 190 | Ga0466701_086289 | 3300042598 | Bacteria | 6463 |
| 191 | Ga0466701_098887 | 3300042598 | Bacteria | 1183 |
| 192 | Ga0466713_054451 | 3300042602 | Bacteria | 168587 |
| 193 | Ga0466713_147325 | 3300042602 | Bacteria | 11615 |
| 194 | Ga0466714_088896 | 3300042603 | Bacteria | 7770 |
| 195 | Ga0466717_194699 | 3300042604 | Unclassified | 1398 |
| 196 | Ga0466720_126660 | 3300042607 | Bacteria | 2761 |
| 197 | Ga0123356_10018029 | 3300010049 | Bacteria | 6706 |
| 198 | Ga0123353_10104384 | 3300010167 | Bacteria | 4567 |
| 199 | Ga0123354_10317277 | 3300010882 | Bacteria | 1444 |
| 200 | Ga0160464_104844 | 3300012805 | Bacteria | 1629 |
| 201 | IMNBL1DRAFT_c0001548 | 3300000062 | Bacteria | 17162 |
| 202 | JGI24702J35022_10000063 | 3300002462 | Bacteria | 45503 |
| 203 | JGI24705J35276_12199861 | 3300002504 | Bacteria | 1592 |
| 204 | JGI24696J40584_12960513 | 3300002834 | Bacteria | 7459 |
| 205 | Ga0072941_1249643 | 3300005201 | Bacteria | 3689 |
| 206 | Ga0466710_085424 | 3300042613 | Bacteria | 3496 |
| 207 | Ga0466710_433498 | 3300042613 | Bacteria | 1251 |
| 208 | Ga0466735_097979 | 3300042624 | Bacteria | 7483 |
| 209 | Ga0466703_116352 | 3300042636 | Bacteria | 2071 |
| 210 | Ga0466704_466863 | 3300042643 | Bacteria | 2382 |
| 211 | Ga0466724_33942 | 3300042649 | Bacteria | 2885 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02749 | GO:0016763 | pentosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.