Protein Family IF04355
Metagenome
Isolate
276
Members
176
Samples
170
Scaffolds
222.38
Avg Length
Representative Sequence
- ID
- 3300042550|Ga0466656_072511|Ga0466656_072511_383_1108
- Length
- 241 aa
- Sequence
- VSVESQYVSAAQRLAGGRLPSVTGGPFLAGGAASSAPSARYVLPQFEERTAYGFKRQDPYTKLFEDRIIFLGVQVDDASADDVMAQLLVLESQDPDRDVILYINSPGGSFTAMTALYDTMLYIKPQIQTVCLGQAASAAAVLLAAGQPGKRLALPNARVVIHQPAMEGGYAQASDIEIQANELIRMREWLEGTLALHTGKTAAQVRQDIERDKVLTAEQAKDYGLVDQVLESRKMVIVNKP
Sample Types
Isolate
38.4%
Metagenome
61.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.2%
Termitidae
11.8%
Apidae
11.2%
Kalotermitidae
7.1%
Culicidae
6.5%
Anthocoridae
5.9%
Cambaridae
5.3%
Scarabaeidae
4.7%
Armadillidiidae
4.1%
Tenebrionidae
3.6%
Elmidae
1.8%
Rhinotermitidae
1.8%
Dytiscidae
1.8%
Hydrophilidae
1.2%
Termopsidae
1.2%
Cerambycidae
1.2%
Hodotermitidae
0.6%
Chironomidae
0.6%
Ixodidae
0.6%
Cimicidae
0.6%
Pyralidae
0.6%
Curculionidae
0.6%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 2 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 3 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 4 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 5 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 6 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 7 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 8 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 17 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 18 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 19 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 20 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 27 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 28 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 29 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 30 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 31 | 2065487017 | Actinobacterium Actino7 (unscreened) | Isolate | Unclassified |
| 32 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 33 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 34 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 35 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 36 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 37 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 38 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 39 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 40 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 41 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 42 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 45 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 50 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 51 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 52 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 53 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 54 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 55 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 56 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 57 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 58 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 59 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 60 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 61 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 62 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 66 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 67 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 68 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 69 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 70 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 71 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 72 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 73 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 74 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 75 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 76 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 77 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 78 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 79 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 80 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 81 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 82 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 83 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 84 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 85 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 86 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 87 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 88 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 89 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 90 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 91 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 92 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 93 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 96 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 97 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 98 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 99 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 100 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 101 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 102 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 103 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 104 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 105 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 106 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 107 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 108 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 109 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 110 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 111 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 112 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 113 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 114 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 115 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 116 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 117 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 118 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 119 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 120 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 121 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 122 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 123 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 124 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 125 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 126 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 127 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 128 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 129 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 130 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 131 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 132 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 133 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 134 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 135 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 136 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 137 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 138 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 139 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 140 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 141 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 142 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 143 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 144 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 145 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 146 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 147 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 148 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 149 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 150 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 151 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 152 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 153 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 154 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 155 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 156 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 157 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 158 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 159 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 160 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 161 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 162 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 163 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 164 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 165 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 166 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 167 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 168 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 169 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 170 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 171 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 172 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 173 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 174 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 175 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 176 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_352135 | 3300042612 | Bacteria | 6315 |
| 2 | Ga0562379_0149 | 3300056790 | Bacteria | 210994 |
| 3 | Ga0562379_1871 | 3300056790 | Bacteria | 20688 |
| 4 | Ga0562375_0570 | 3300056856 | Bacteria | 72897 |
| 5 | Ga0562375_3677 | 3300056856 | Bacteria | 13700 |
| 6 | Ga0562376_0113 | 3300056857 | Bacteria | 183281 |
| 7 | Ga0562376_1859 | 3300056857 | Bacteria | 27726 |
| 8 | Ga0562376_3638 | 3300056857 | Bacteria | 15040 |
| 9 | Ga0123356_10028990 | 3300010049 | Unclassified | 5186 |
| 10 | Ga0123353_10000728 | 3300010167 | Bacteria | 40136 |
| 11 | JGI24699J35502_11134059 | 3300002509 | Bacteria | 27570 |
| 12 | Ga0466706_054195 | 3300042599 | Bacteria | 16453 |
| 13 | Ga0160453_102436 | 3300012814 | Bacteria | 4566 |
| 14 | Ga0160469_100431 | 3300012824 | Bacteria | 20644 |
| 15 | Ga0160445_110304 | 3300012847 | Bacteria | 1382 |
| 16 | Ga0466656_072511 | 3300042550 | Bacteria | 1256 |
| 17 | Ga0466693_204487 | 3300042592 | Bacteria | 8581 |
| 18 | Ga0466696_452125 | 3300042596 | Bacteria | 18093 |
| 19 | Ga0466703_415166 | 3300042636 | Bacteria | 10943 |
| 20 | Ga0466708_174391 | 3300042652 | Bacteria | 8893 |
| 21 | Ga0466725_419199 | 3300042654 | Bacteria | 2059 |
| 22 | Ga0466726_119442 | 3300042619 | Bacteria | 1102 |
| 23 | Ga0466728_326027 | 3300042620 | Bacteria | 11345 |
| 24 | Ga0562375_0051 | 3300056856 | Bacteria | 467539 |
| 25 | Ga0562375_0295 | 3300056856 | Bacteria | 125606 |
| 26 | Ga0562375_2072 | 3300056856 | Bacteria | 23773 |
| 27 | Ga0562375_3300 | 3300056856 | Unclassified | 15488 |
| 28 | Ga0562375_4022 | 3300056856 | Bacteria | 12165 |
| 29 | Ga0562376_0027 | 3300056857 | Bacteria | 397453 |
| 30 | Ga0123356_10039931 | 3300010049 | Unclassified | 4372 |
| 31 | Ga0160464_102113 | 3300012805 | Bacteria | 4213 |
| 32 | Ga0160471_104409 | 3300012812 | Bacteria | 1982 |
| 33 | Ga0072940_1077265 | 3300005200 | Bacteria | 7399 |
| 34 | Ga0466700_276839 | 3300042600 | Bacteria | 1256 |
| 35 | Ga0466713_058497 | 3300042602 | Bacteria | 3432 |
| 36 | Ga0466714_093759 | 3300042603 | Bacteria | 2061 |
| 37 | Ga0466716_422493 | 3300042605 | Bacteria | 2010 |
| 38 | Ga0160432_101830 | 3300012818 | Bacteria | 5723 |
| 39 | Ga0160452_100017 | 3300012834 | Bacteria | 282630 |
| 40 | Ga0160455_100413 | 3300012837 | Bacteria | 23297 |
| 41 | Ga0160444_103578 | 3300012841 | Bacteria | 2203 |
| 42 | Ga0160435_1000546 | 3300012857 | Bacteria | 11667 |
| 43 | Ga0466693_422296 | 3300042592 | Bacteria | 9990 |
| 44 | Ga0466696_479568 | 3300042596 | Bacteria | 2899 |
| 45 | Ga0466734_052993 | 3300042623 | Bacteria | 1065 |
| 46 | Ga0466705_031846 | 3300042612 | Bacteria | 3564 |
| 47 | Ga0123356_10423912 | 3300010049 | Unclassified | 1473 |
| 48 | Ga0123354_10118876 | 3300010882 | Bacteria | 3428 |
| 49 | HBC_ctgsDRAFT_1009073 | 3300000333 | Unclassified | 2361 |
| 50 | Ga0466707_225228 | 3300042601 | Bacteria | 1156 |
| 51 | Ga0466707_309978 | 3300042601 | Bacteria | 16368 |
| 52 | Ga0466713_033429 | 3300042602 | Bacteria | 27281 |
| 53 | Ga0160470_108894 | 3300012813 | Bacteria | 989 |
| 54 | Ga0160460_102624 | 3300012845 | Unclassified | 3840 |
| 55 | Ga0160443_100252 | 3300012848 | Bacteria | 56331 |
| 56 | Ga0466692_184549 | 3300042591 | Bacteria | 1339 |
| 57 | Ga0466729_215027 | 3300042621 | Bacteria | 3277 |
| 58 | Ga0466734_104445 | 3300042623 | Bacteria | 2195 |
| 59 | Ga0466730_063363 | 3300042625 | Bacteria | 2304 |
| 60 | Ga0466703_072346 | 3300042636 | Bacteria | 156211 |
| 61 | Ga0466725_315373 | 3300042654 | Bacteria | 2201 |
| 62 | Ga0466710_211728 | 3300042613 | Bacteria | 6550 |
| 63 | Ga0466711_100411 | 3300042615 | Bacteria | 1863 |
| 64 | Ga0466723_007957 | 3300042618 | Bacteria | 2791 |
| 65 | Ga0466723_046348 | 3300042618 | Bacteria | 2328 |
| 66 | Ga0466723_288161 | 3300042618 | Bacteria | 7198 |
| 67 | Ga0466723_305617 | 3300042618 | Bacteria | 3267 |
| 68 | Ga0466728_162105 | 3300042620 | Unclassified | 2827 |
| 69 | Ga0466705_276345 | 3300042612 | Bacteria | 9967 |
| 70 | Ga0562378_0002 | 3300056814 | Bacteria | 3519472 |
| 71 | Ga0562378_0117 | 3300056814 | Bacteria | 208061 |
| 72 | Ga0562375_0028 | 3300056856 | Bacteria | 708255 |
| 73 | Ga0562375_6112 | 3300056856 | Unclassified | 5782 |
| 74 | Ga0562376_3438 | 3300056857 | Bacteria | 15883 |
| 75 | Ga0466716_246795 | 3300042605 | Bacteria | 1651 |
| 76 | Ga0160430_102956 | 3300012852 | Unclassified | 5018 |
| 77 | Ga0160430_106080 | 3300012852 | Bacteria | 2643 |
| 78 | Ga0466703_238548 | 3300042636 | Bacteria | 10421 |
| 79 | Ga0466704_122764 | 3300042643 | Bacteria | 12234 |
| 80 | Ga0466704_319727 | 3300042643 | Bacteria | 2299 |
| 81 | Ga0466704_418612 | 3300042643 | Bacteria | 6392 |
| 82 | Ga0466725_055659 | 3300042654 | Bacteria | 1073 |
| 83 | Ga0466727_104595 | 3300042655 | Bacteria | 5361 |
| 84 | Ga0466723_060842 | 3300042618 | Bacteria | 35094 |
| 85 | Ga0562378_0012 | 3300056814 | Bacteria | 1041899 |
| 86 | Ga0562377_3061 | 3300056842 | Unclassified | 9897 |
| 87 | Ga0562375_1461 | 3300056856 | Bacteria | 31736 |
| 88 | Ga0123356_10000179 | 3300010049 | Bacteria | 72167 |
| 89 | Ga0123356_10000416 | 3300010049 | Bacteria | 48609 |
| 90 | Ga0123353_10407994 | 3300010167 | Unclassified | 2019 |
| 91 | JGI24699J35502_11126284 | 3300002509 | Bacteria | 3936 |
| 92 | Ga0466707_043723 | 3300042601 | Bacteria | 96072 |
| 93 | Ga0466707_053252 | 3300042601 | Bacteria | 5585 |
| 94 | Ga0466716_082489 | 3300042605 | Bacteria | 33521 |
| 95 | Ga0466716_118922 | 3300042605 | Bacteria | 11617 |
| 96 | Ga0466716_159388 | 3300042605 | Bacteria | 1602 |
| 97 | Ga0160453_100639 | 3300012814 | Bacteria | 22591 |
| 98 | Ga0160459_101634 | 3300012831 | Bacteria | 4496 |
| 99 | Ga0160444_110608 | 3300012841 | Bacteria | 1122 |
| 100 | Ga0160447_106793 | 3300012849 | Bacteria | 2967 |
| 101 | Ga0160430_101687 | 3300012852 | Unclassified | 7843 |
| 102 | Ga0160435_1003244 | 3300012857 | Bacteria | 3870 |
| 103 | Ga0160436_1000233 | 3300012861 | Unclassified | 26692 |
| 104 | Ga0466696_079004 | 3300042596 | Bacteria | 4186 |
| 105 | Ga0466696_112680 | 3300042596 | Bacteria | 2655 |
| 106 | Ga0466715_430786 | 3300042616 | Bacteria | 4152 |
| 107 | Ga0466715_597961 | 3300042616 | Bacteria | 2437 |
| 108 | Ga0466718_032126 | 3300042617 | Bacteria | 1632 |
| 109 | Ga0466723_133512 | 3300042618 | Bacteria | 8021 |
| 110 | Ga0466705_385115 | 3300042612 | Bacteria | 7034 |
| 111 | Ga0562375_0360 | 3300056856 | Unclassified | 104924 |
| 112 | Ga0562376_1511 | 3300056857 | Bacteria | 32176 |
| 113 | Ga0562376_3680 | 3300056857 | Unclassified | 14817 |
| 114 | Ga0123356_10001422 | 3300010049 | Bacteria | 26473 |
| 115 | Ga0123353_10036529 | 3300010167 | Bacteria | 7695 |
| 116 | Ga0160442_100013 | 3300012806 | Bacteria | 424413 |
| 117 | AglaG_contig01651 | 2084038013 | Bacteria | 2400 |
| 118 | JGI24703J35330_11716197 | 3300002501 | Bacteria | 2279 |
| 119 | Ga0466706_131529 | 3300042599 | Bacteria | 7890 |
| 120 | Ga0466707_093240 | 3300042601 | Bacteria | 2956 |
| 121 | Ga0466722_002434 | 3300042609 | Bacteria | 1572 |
| 122 | Ga0466722_010005 | 3300042609 | Bacteria | 3122 |
| 123 | Ga0160446_100075 | 3300012835 | Bacteria | 97725 |
| 124 | Ga0160434_103346 | 3300012850 | Bacteria | 2713 |
| 125 | Ga0160436_1011744 | 3300012861 | Bacteria | 1869 |
| 126 | Ga0466692_037868 | 3300042591 | Bacteria | 3495 |
| 127 | Ga0466691_064500 | 3300042593 | Bacteria | 4494 |
| 128 | Ga0466730_007781 | 3300042625 | Bacteria | 144154 |
| 129 | Ga0466724_04140 | 3300042649 | Bacteria | 51513 |
| 130 | Ga0466724_36962 | 3300042649 | Bacteria | 194212 |
| 131 | Ga0466708_047907 | 3300042652 | Bacteria | 31421 |
| 132 | Ga0466711_035294 | 3300042615 | Bacteria | 2130 |
| 133 | Ga0562375_0001 | 3300056856 | Bacteria | 3661630 |
| 134 | Ga0562375_0006 | 3300056856 | Bacteria | 2261894 |
| 135 | Ga0562376_0033 | 3300056857 | Bacteria | 349823 |
| 136 | Ga0562376_0189 | 3300056857 | Bacteria | 129394 |
| 137 | Ga0562376_0959 | 3300056857 | Bacteria | 44579 |
| 138 | Ga0160466_102271 | 3300012809 | Unclassified | 3958 |
| 139 | AustNasuHG_c1000081 | 3300000089 | Bacteria | 27217 |
| 140 | Ga0074278_147618 | 3300005721 | Bacteria | 9197 |
| 141 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 142 | Ga0160452_105900 | 3300012834 | Bacteria | 1745 |
| 143 | Ga0160434_105937 | 3300012850 | Unclassified | 2021 |
| 144 | Ga0160457_1000017 | 3300012858 | Bacteria | 384973 |
| 145 | Ga0466703_421941 | 3300042636 | Bacteria | 45890 |
| 146 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 147 | Ga0466723_242381 | 3300042618 | Bacteria | 71488 |
| 148 | Ga0466728_388641 | 3300042620 | Bacteria | 1230 |
| 149 | Ga0530661_000958 | 3300056564 | Bacteria | 17098 |
| 150 | Ga0562379_0382 | 3300056790 | Bacteria | 101272 |
| 151 | Ga0562377_0055 | 3300056842 | Bacteria | 513141 |
| 152 | Ga0562375_0307 | 3300056856 | Bacteria | 120979 |
| 153 | Ga0562375_3861 | 3300056856 | Bacteria | 12815 |
| 154 | Ga0123356_10006222 | 3300010049 | Bacteria | 12065 |
| 155 | Ga0072940_1309263 | 3300005200 | Bacteria | 947 |
| 156 | Ga0466707_018854 | 3300042601 | Bacteria | 92056 |
| 157 | Ga0466714_017580 | 3300042603 | Bacteria | 3235 |
| 158 | Ga0466719_079865 | 3300042606 | Bacteria | 2996 |
| 159 | Ga0466719_382230 | 3300042606 | Bacteria | 59148 |
| 160 | Ga0466719_506489 | 3300042606 | Bacteria | 4754 |
| 161 | Ga0466722_071386 | 3300042609 | Bacteria | 17757 |
| 162 | Ga0160432_100186 | 3300012818 | Bacteria | 54846 |
| 163 | Ga0160467_112492 | 3300012829 | Bacteria | 722 |
| 164 | Ga0160447_100750 | 3300012849 | Bacteria | 14019 |
| 165 | Ga0160448_100311 | 3300012854 | Bacteria | 18257 |
| 166 | Ga0466691_143852 | 3300042593 | Bacteria | 13971 |
| 167 | Ga0466696_053165 | 3300042596 | Bacteria | 2323 |
| 168 | Ga0466730_031814 | 3300042625 | Unclassified | 13652 |
| 169 | Ga0466711_184794 | 3300042615 | Bacteria | 29629 |
| 170 | Ga0466715_343342 | 3300042616 | Bacteria | 53918 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00574 | CLP_protease | Clp protease | 56 | 232 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.