Protein Family IF04353
Metagenome
Metatranscriptome
Isolate
156
Members
57
Samples
148
Scaffolds
149.47
Avg Length
Representative Sequence
- ID
- 3300041968|Ga0456237_0031120|Ga0456237_0031120_28_561
- Length
- 177 aa
- Sequence
- MLRHYLFGGRPVLDVLPQGRLPPQGLLGRFLGACSLNLQCHIPLLYQHVHRFPAGNGGAKNREFKQELGKDDFLKLLLTQLAYQDPTAPMEDKEFIAQMAQFSSLEQMNRMADDFSKMAQMLTGNEAASALGRSVELTEGDRAIQGTVDAVTRGGAPQILVNGAYYPWEQVAKVFQE
Sample Types
Isolate
5.1%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
1.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.4%
Kalotermitidae
26.4%
Unclassified
20.8%
Rhinotermitidae
5.7%
Termopsidae
3.8%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 9 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 10 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 11 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 23 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 52 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_096486 | 3300042612 | Bacteria | 4312 |
| 2 | Ga0466705_202934 | 3300042612 | Bacteria | 22495 |
| 3 | JGI24698J34947_10164446 | 3300002449 | Bacteria | 905 |
| 4 | JGI24699J35502_11126941 | 3300002509 | Bacteria | 4054 |
| 5 | Ga0068305_10111264 | 3300005083 | Unclassified | 1848 |
| 6 | Ga0123356_11138596 | 3300010049 | Bacteria | 948 |
| 7 | Ga0466712_051240 | 3300042614 | Bacteria | 13922 |
| 8 | Ga0466723_104280 | 3300042618 | Bacteria | 10579 |
| 9 | Ga0466726_007029 | 3300042619 | Bacteria | 2175 |
| 10 | Ga0466726_435788 | 3300042619 | Bacteria | 4377 |
| 11 | Ga0466728_180774 | 3300042620 | Archaea | 2426 |
| 12 | Ga0264413_106320 | 3300024493 | Bacteria | 7156 |
| 13 | Ga0466692_019058 | 3300042591 | Bacteria | 1929 |
| 14 | Ga0466692_063890 | 3300042591 | Bacteria | 1466 |
| 15 | Ga0466696_088887 | 3300042596 | Bacteria | 2520 |
| 16 | Ga0466699_176709 | 3300042597 | Bacteria | 1026 |
| 17 | Ga0466719_367993 | 3300042606 | Bacteria | 2998 |
| 18 | Ga0466731_239227 | 3300042622 | Bacteria | 2324 |
| 19 | Ga0466702_219650 | 3300042635 | Bacteria | 2234 |
| 20 | Ga0466702_318539 | 3300042635 | Bacteria | 2682 |
| 21 | Ga0466704_129323 | 3300042643 | Bacteria | 30783 |
| 22 | JGI24698J34947_10046752 | 3300002449 | Bacteria | 2200 |
| 23 | JGI24695J34938_10003776 | 3300002450 | Bacteria | 10320 |
| 24 | JGI24699J35502_10966653 | 3300002509 | Bacteria | 1221 |
| 25 | Ga0466712_134049 | 3300042614 | Bacteria | 14248 |
| 26 | Ga0466711_484332 | 3300042615 | Bacteria | 1010 |
| 27 | Ga0466726_256029 | 3300042619 | Bacteria | 10968 |
| 28 | Ga0466707_159916 | 3300042601 | Bacteria | 2249 |
| 29 | Ga0466722_200252 | 3300042609 | Bacteria | 4289 |
| 30 | Ga0466722_232797 | 3300042609 | Bacteria | 1497 |
| 31 | Ga0466709_407211 | 3300042648 | Bacteria | 2714 |
| 32 | Ga0466708_143022 | 3300042652 | Bacteria | 4402 |
| 33 | Ga0466708_220073 | 3300042652 | Bacteria | 4928 |
| 34 | Ga0466727_135439 | 3300042655 | Bacteria | 1821 |
| 35 | AustNasuHG_c1004111 | 3300000089 | Bacteria | 5225 |
| 36 | AustNasuHG_c1039185 | 3300000089 | Bacteria | 1181 |
| 37 | AustNasuHG_c1060106 | 3300000089 | Bacteria | 741 |
| 38 | JGI24698J34947_10105893 | 3300002449 | Bacteria | 1252 |
| 39 | Ga0123356_10000561 | 3300010049 | Bacteria | 41259 |
| 40 | Ga0123356_11053592 | 3300010049 | Bacteria | 982 |
| 41 | Ga0466723_105730 | 3300042618 | Bacteria | 2689 |
| 42 | Ga0466726_014076 | 3300042619 | Bacteria | 1169 |
| 43 | Ga0466691_067236 | 3300042593 | Bacteria | 9817 |
| 44 | Ga0466720_021273 | 3300042607 | Bacteria | 41620 |
| 45 | Ga0466720_039534 | 3300042607 | Bacteria | 41363 |
| 46 | Ga0466721_130440 | 3300042608 | Bacteria | 13834 |
| 47 | Ga0466722_046520 | 3300042609 | Bacteria | 7615 |
| 48 | Ga0466722_056505 | 3300042609 | Bacteria | 5681 |
| 49 | Ga0466730_081279 | 3300042625 | Bacteria | 1504 |
| 50 | Ga0466704_517890 | 3300042643 | Unclassified | 5893 |
| 51 | AustNasuHG_c1000005 | 3300000089 | Bacteria | 56942 |
| 52 | AustNasuHG_c1033138 | 3300000089 | Bacteria | 1414 |
| 53 | Ga0123356_10258500 | 3300010049 | Bacteria | 1824 |
| 54 | Ga0466726_348996 | 3300042619 | Bacteria | 1311 |
| 55 | Ga0466726_372165 | 3300042619 | Bacteria | 3359 |
| 56 | Ga0415639_104729 | 3300038395 | Bacteria | 5030 |
| 57 | Ga0466691_126007 | 3300042593 | Bacteria | 12051 |
| 58 | Ga0466722_064604 | 3300042609 | Bacteria | 35013 |
| 59 | Ga0466698_165292 | 3300042610 | Bacteria | 1037 |
| 60 | Ga0466731_247908 | 3300042622 | Bacteria | 2843 |
| 61 | Ga0466702_063047 | 3300042635 | Bacteria | 15583 |
| 62 | Ga0466702_164414 | 3300042635 | Bacteria | 3234 |
| 63 | Ga0466725_431682 | 3300042654 | Bacteria | 1052 |
| 64 | Ga0466705_368844 | 3300042612 | Bacteria | 2590 |
| 65 | Ga0068305_10300495 | 3300005083 | Bacteria | 2359 |
| 66 | Ga0123355_10039063 | 3300009826 | Bacteria | 7720 |
| 67 | Ga0123353_10154236 | 3300010167 | Bacteria | 3664 |
| 68 | Ga0466705_512534 | 3300042612 | Bacteria | 1226 |
| 69 | Ga0466711_336225 | 3300042615 | Bacteria | 4982 |
| 70 | Ga0466718_132248 | 3300042617 | Bacteria | 1494 |
| 71 | Ga0466723_281966 | 3300042618 | Bacteria | 5064 |
| 72 | Ga0466723_318315 | 3300042618 | Unclassified | 4426 |
| 73 | Ga0466726_209556 | 3300042619 | Bacteria | 1060 |
| 74 | Ga0223675_1020185 | 3300021237 | Bacteria | 1509 |
| 75 | Ga0466690_144218 | 3300042590 | Bacteria | 24655 |
| 76 | Ga0466690_332150 | 3300042590 | Bacteria | 20439 |
| 77 | Ga0466692_150572 | 3300042591 | Bacteria | 1804 |
| 78 | Ga0466694_019833 | 3300042594 | Bacteria | 5085 |
| 79 | Ga0466694_245366 | 3300042594 | Bacteria | 1659 |
| 80 | Ga0466699_237923 | 3300042597 | Bacteria | 1415 |
| 81 | Ga0466713_010281 | 3300042602 | Bacteria | 2085 |
| 82 | Ga0466717_050448 | 3300042604 | Bacteria | 1899 |
| 83 | Ga0466722_009932 | 3300042609 | Bacteria | 19464 |
| 84 | Ga0466722_032017 | 3300042609 | Bacteria | 7915 |
| 85 | Ga0466722_104195 | 3300042609 | Bacteria | 4356 |
| 86 | Ga0466731_390840 | 3300042622 | Bacteria | 1064 |
| 87 | Ga0466708_167010 | 3300042652 | Bacteria | 9765 |
| 88 | Ga0466708_450428 | 3300042652 | Bacteria | 1280 |
| 89 | Ga0466705_202591 | 3300042612 | Bacteria | 4711 |
| 90 | FAAS_10422069 | 3300001880 | Bacteria | 544 |
| 91 | JGI24702J35022_10478811 | 3300002462 | Bacteria | 761 |
| 92 | Ga0068305_10025194 | 3300005083 | Bacteria | 16801 |
| 93 | Ga0072940_1163487 | 3300005200 | Unclassified | 643 |
| 94 | Ga0123356_10019008 | 3300010049 | Bacteria | 6519 |
| 95 | Ga0123356_10517352 | 3300010049 | Bacteria | 1351 |
| 96 | Ga0466712_025312 | 3300042614 | Bacteria | 8909 |
| 97 | Ga0466712_127955 | 3300042614 | Bacteria | 54818 |
| 98 | Ga0466711_501168 | 3300042615 | Bacteria | 17841 |
| 99 | Ga0466715_112871 | 3300042616 | Bacteria | 8877 |
| 100 | Ga0223674_1000307 | 3300021235 | Bacteria | 2032 |
| 101 | Ga0415639_001978 | 3300038395 | Bacteria | 17701 |
| 102 | Ga0466690_041103 | 3300042590 | Bacteria | 2925 |
| 103 | Ga0466692_004135 | 3300042591 | Bacteria | 1503 |
| 104 | Ga0466692_148219 | 3300042591 | Bacteria | 1146 |
| 105 | Ga0466692_191335 | 3300042591 | Bacteria | 3588 |
| 106 | Ga0466691_129862 | 3300042593 | Bacteria | 25527 |
| 107 | Ga0466696_241750 | 3300042596 | Bacteria | 6414 |
| 108 | Ga0466716_148176 | 3300042605 | Bacteria | 3095 |
| 109 | Ga0466703_084058 | 3300042636 | Bacteria | 18270 |
| 110 | Ga0466709_131464 | 3300042648 | Bacteria | 11431 |
| 111 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 112 | JGI24695J34938_10000090 | 3300002450 | Bacteria | 79670 |
| 113 | Ga0072940_1012382 | 3300005200 | Bacteria | 4522 |
| 114 | Ga0123356_10487143 | 3300010049 | Bacteria | 1387 |
| 115 | Ga0123356_11763455 | 3300010049 | Bacteria | 769 |
| 116 | Ga0466711_026706 | 3300042615 | Bacteria | 17084 |
| 117 | Ga0466718_060878 | 3300042617 | Bacteria | 7771 |
| 118 | Ga0466723_204546 | 3300042618 | Bacteria | 2904 |
| 119 | Ga0466726_080328 | 3300042619 | Bacteria | 5074 |
| 120 | Ga0415639_073106 | 3300038395 | Unclassified | 5004 |
| 121 | Ga0466693_035382 | 3300042592 | Bacteria | 1358 |
| 122 | Ga0466696_068095 | 3300042596 | Unclassified | 1014 |
| 123 | Ga0466719_167636 | 3300042606 | Bacteria | 13755 |
| 124 | Ga0466702_310112 | 3300042635 | Bacteria | 1658 |
| 125 | Ga0466703_044738 | 3300042636 | Bacteria | 12308 |
| 126 | Ga0466704_084636 | 3300042643 | Bacteria | 4755 |
| 127 | Ga0466727_204077 | 3300042655 | Bacteria | 1014 |
| 128 | Ga0123356_10551815 | 3300010049 | Bacteria | 1313 |
| 129 | Ga0123356_11387995 | 3300010049 | Bacteria | 863 |
| 130 | Ga0466715_310326 | 3300042616 | Bacteria | 12799 |
| 131 | Ga0466715_312696 | 3300042616 | Bacteria | 1663 |
| 132 | Ga0466723_021098 | 3300042618 | Bacteria | 13541 |
| 133 | Ga0466728_184717 | 3300042620 | Bacteria | 25131 |
| 134 | Ga0223675_1059422 | 3300021237 | Bacteria | 1457 |
| 135 | Ga0264413_105285 | 3300024493 | Bacteria | 17894 |
| 136 | Ga0456237_0031120 | 3300041968 | Bacteria | 716 |
| 137 | Ga0466690_000197 | 3300042590 | Bacteria | 7666 |
| 138 | Ga0466692_022965 | 3300042591 | Bacteria | 1426 |
| 139 | Ga0466692_092840 | 3300042591 | Bacteria | 19467 |
| 140 | Ga0466691_174739 | 3300042593 | Bacteria | 4643 |
| 141 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 142 | Ga0466719_059213 | 3300042606 | Bacteria | 3345 |
| 143 | Ga0466722_076380 | 3300042609 | Bacteria | 2901 |
| 144 | Ga0466722_160110 | 3300042609 | Bacteria | 27287 |
| 145 | Ga0466703_378440 | 3300042636 | Bacteria | 1850 |
| 146 | Ga0466704_278756 | 3300042643 | Bacteria | 3511 |
| 147 | Ga0466708_049691 | 3300042652 | Bacteria | 11825 |
| 148 | Ga0466727_260529 | 3300042655 | Bacteria | 1884 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03963 | FlgD | Flagellar hook capping protein - N-terminal region | 59 | 115 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.