Protein Family IF04352
Metagenome
Isolate
169
Members
26
Samples
166
Scaffolds
227.88
Avg Length
Representative Sequence
- ID
- 3300041968|Ga0456237_0013041|Ga0456237_0013041_337_1146
- Length
- 269 aa
- Sequence
- LPRQKTPGARGWRNEKAAAGQRCGNGFCGLHGDGGMNAQVFFDIFTPPRIRHVLAGLRMTILISLATVFLSVLLGSVLAICRSYSRRIAGRAASVYIEIFRSTPLLLWILFCIFMLPFGNIALRGGLGLTLYTGSVIAEIVRGGLNAIDRGQYDAARSQGFNFVQCLRYIVLPQCFMHIVPSLMSQIITTIKDTSFLAQFAIAEFFFNSKQLLGIISRDTVLTSAHIFVLYGFIALVYFTVNFVFSCLVRALAKPEQALFRRRKSANPP
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
53.8%
Unclassified
19.2%
Rhinotermitidae
11.5%
Termopsidae
11.5%
Hodotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 16 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_038541 | 3300042612 | Bacteria | 17641 |
| 2 | Ga0466705_283057 | 3300042612 | Bacteria | 16700 |
| 3 | Ga0466719_187181 | 3300042606 | Bacteria | 5233 |
| 4 | Ga0466719_373791 | 3300042606 | Bacteria | 6066 |
| 5 | Ga0466690_043773 | 3300042590 | Bacteria | 12402 |
| 6 | Ga0466690_323981 | 3300042590 | Bacteria | 2548 |
| 7 | Ga0466711_129633 | 3300042615 | Bacteria | 8400 |
| 8 | Ga0466711_207258 | 3300042615 | Bacteria | 1854 |
| 9 | Ga0466715_070104 | 3300042616 | Bacteria | 8118 |
| 10 | Ga0466715_187758 | 3300042616 | Bacteria | 4757 |
| 11 | Ga0466728_133773 | 3300042620 | Bacteria | 1384 |
| 12 | Ga0466728_197164 | 3300042620 | Bacteria | 4248 |
| 13 | Ga0466728_207863 | 3300042620 | Bacteria | 7080 |
| 14 | Ga0466728_302268 | 3300042620 | Bacteria | 11991 |
| 15 | Ga0466728_397212 | 3300042620 | Bacteria | 4886 |
| 16 | Ga0466735_120105 | 3300042624 | Bacteria | 1505 |
| 17 | Ga0466703_339649 | 3300042636 | Bacteria | 7039 |
| 18 | Ga0466704_069308 | 3300042643 | Bacteria | 4165 |
| 19 | Ga0466704_275129 | 3300042643 | Bacteria | 1472 |
| 20 | Ga0466709_339392 | 3300042648 | Bacteria | 10108 |
| 21 | Ga0466708_030177 | 3300042652 | Bacteria | 1443 |
| 22 | Ga0466708_217800 | 3300042652 | Bacteria | 27433 |
| 23 | Ga0068305_10037418 | 3300005083 | Bacteria | 10822 |
| 24 | Ga0466690_369796 | 3300042590 | Bacteria | 5897 |
| 25 | Ga0466696_383115 | 3300042596 | Bacteria | 5419 |
| 26 | Ga0466696_408056 | 3300042596 | Bacteria | 24375 |
| 27 | Ga0466696_499351 | 3300042596 | Bacteria | 4533 |
| 28 | Ga0466715_056475 | 3300042616 | Bacteria | 16375 |
| 29 | Ga0466715_091290 | 3300042616 | Bacteria | 11267 |
| 30 | Ga0466715_206111 | 3300042616 | Unclassified | 8899 |
| 31 | Ga0466723_299049 | 3300042618 | Bacteria | 13030 |
| 32 | Ga0466726_045435 | 3300042619 | Bacteria | 1405 |
| 33 | Ga0466726_366248 | 3300042619 | Bacteria | 2593 |
| 34 | Ga0466728_474170 | 3300042620 | Bacteria | 13531 |
| 35 | Ga0466735_079522 | 3300042624 | Unclassified | 1769 |
| 36 | Ga0466703_039542 | 3300042636 | Bacteria | 15502 |
| 37 | Ga0466704_080270 | 3300042643 | Bacteria | 7475 |
| 38 | Ga0466704_277279 | 3300042643 | Bacteria | 14132 |
| 39 | Ga0466709_305497 | 3300042648 | Bacteria | 1774 |
| 40 | Ga0466727_066233 | 3300042655 | Bacteria | 4372 |
| 41 | Ga0466727_105437 | 3300042655 | Bacteria | 1318 |
| 42 | Ga0466705_275797 | 3300042612 | Bacteria | 6454 |
| 43 | Ga0466707_403365 | 3300042601 | Unclassified | 1428 |
| 44 | Ga0466719_357732 | 3300042606 | Bacteria | 7517 |
| 45 | Ga0456237_0013041 | 3300041968 | Bacteria | 1197 |
| 46 | Ga0466690_098431 | 3300042590 | Bacteria | 10704 |
| 47 | Ga0466691_212116 | 3300042593 | Bacteria | 3423 |
| 48 | Ga0466691_228099 | 3300042593 | Bacteria | 7532 |
| 49 | Ga0466696_145625 | 3300042596 | Bacteria | 1236 |
| 50 | Ga0466705_427773 | 3300042612 | Bacteria | 83042 |
| 51 | Ga0466711_154963 | 3300042615 | Bacteria | 2380 |
| 52 | Ga0466711_491707 | 3300042615 | Bacteria | 1018 |
| 53 | Ga0466715_090287 | 3300042616 | Bacteria | 2200 |
| 54 | Ga0466715_360925 | 3300042616 | Bacteria | 2243 |
| 55 | Ga0466723_294766 | 3300042618 | Bacteria | 5366 |
| 56 | Ga0466723_364920 | 3300042618 | Bacteria | 2096 |
| 57 | Ga0466703_092023 | 3300042636 | Bacteria | 6584 |
| 58 | Ga0466708_147304 | 3300042652 | Bacteria | 47180 |
| 59 | Ga0466708_413541 | 3300042652 | Bacteria | 2022 |
| 60 | Ga0466727_156093 | 3300042655 | Bacteria | 1547 |
| 61 | Ga0466707_025624 | 3300042601 | Bacteria | 4308 |
| 62 | Ga0466716_034727 | 3300042605 | Bacteria | 16234 |
| 63 | Ga0466716_506158 | 3300042605 | Bacteria | 1037 |
| 64 | Ga0466719_047082 | 3300042606 | Bacteria | 2209 |
| 65 | Ga0466722_232999 | 3300042609 | Bacteria | 2328 |
| 66 | Ga0466690_038805 | 3300042590 | Unclassified | 3286 |
| 67 | Ga0466691_009988 | 3300042593 | Bacteria | 3965 |
| 68 | Ga0466691_081635 | 3300042593 | Bacteria | 50840 |
| 69 | Ga0466696_019579 | 3300042596 | Bacteria | 8754 |
| 70 | Ga0466696_248359 | 3300042596 | Bacteria | 2400 |
| 71 | Ga0466705_431019 | 3300042612 | Bacteria | 2142 |
| 72 | Ga0466715_083855 | 3300042616 | Bacteria | 7906 |
| 73 | Ga0466715_167336 | 3300042616 | Bacteria | 4992 |
| 74 | Ga0466715_171919 | 3300042616 | Bacteria | 3513 |
| 75 | Ga0466726_330954 | 3300042619 | Bacteria | 4476 |
| 76 | Ga0466726_439621 | 3300042619 | Bacteria | 2325 |
| 77 | Ga0466726_491217 | 3300042619 | Bacteria | 3312 |
| 78 | Ga0466728_082683 | 3300042620 | Bacteria | 1961 |
| 79 | Ga0466704_054263 | 3300042643 | Bacteria | 2806 |
| 80 | Ga0466709_377760 | 3300042648 | Bacteria | 4294 |
| 81 | Ga0466727_059275 | 3300042655 | Unclassified | 2666 |
| 82 | Ga0466705_207013 | 3300042612 | Bacteria | 7944 |
| 83 | Ga0466705_386636 | 3300042612 | Bacteria | 9511 |
| 84 | Ga0466707_026570 | 3300042601 | Bacteria | 4800 |
| 85 | Ga0466707_068639 | 3300042601 | Bacteria | 42326 |
| 86 | Ga0466716_007985 | 3300042605 | Bacteria | 13976 |
| 87 | Ga0068305_10038418 | 3300005083 | Bacteria | 36803 |
| 88 | Ga0466705_464192 | 3300042612 | Bacteria | 2894 |
| 89 | Ga0466715_129347 | 3300042616 | Bacteria | 25762 |
| 90 | Ga0466715_393493 | 3300042616 | Bacteria | 42943 |
| 91 | Ga0466723_085220 | 3300042618 | Bacteria | 6119 |
| 92 | Ga0466726_107937 | 3300042619 | Bacteria | 1892 |
| 93 | Ga0466726_133179 | 3300042619 | Bacteria | 1115 |
| 94 | Ga0466726_450156 | 3300042619 | Bacteria | 3111 |
| 95 | Ga0466728_307196 | 3300042620 | Bacteria | 6807 |
| 96 | Ga0466729_143029 | 3300042621 | Bacteria | 3554 |
| 97 | Ga0466735_090378 | 3300042624 | Bacteria | 7345 |
| 98 | Ga0466703_105797 | 3300042636 | Bacteria | 10494 |
| 99 | Ga0466704_065702 | 3300042643 | Bacteria | 8220 |
| 100 | Ga0466709_026801 | 3300042648 | Bacteria | 29637 |
| 101 | Ga0466727_060040 | 3300042655 | Bacteria | 2186 |
| 102 | Ga0466707_074974 | 3300042601 | Bacteria | 1574 |
| 103 | Ga0466707_176596 | 3300042601 | Bacteria | 1797 |
| 104 | Ga0466719_334266 | 3300042606 | Bacteria | 3284 |
| 105 | Ga0466719_541086 | 3300042606 | Bacteria | 2528 |
| 106 | Ga0068305_10120300 | 3300005083 | Bacteria | 1423 |
| 107 | Ga0466691_057335 | 3300042593 | Bacteria | 3098 |
| 108 | Ga0466691_191331 | 3300042593 | Bacteria | 8446 |
| 109 | Ga0466715_177856 | 3300042616 | Bacteria | 2021 |
| 110 | Ga0466715_262634 | 3300042616 | Bacteria | 2415 |
| 111 | Ga0466723_064442 | 3300042618 | Bacteria | 17565 |
| 112 | Ga0466723_149877 | 3300042618 | Bacteria | 1518 |
| 113 | Ga0466726_134917 | 3300042619 | Bacteria | 1306 |
| 114 | Ga0466726_417420 | 3300042619 | Bacteria | 1983 |
| 115 | Ga0466735_009580 | 3300042624 | Bacteria | 5652 |
| 116 | Ga0466703_340251 | 3300042636 | Bacteria | 1167 |
| 117 | Ga0466703_415226 | 3300042636 | Bacteria | 3818 |
| 118 | Ga0466704_039302 | 3300042643 | Bacteria | 5388 |
| 119 | Ga0466709_066304 | 3300042648 | Bacteria | 14836 |
| 120 | Ga0466709_103451 | 3300042648 | Bacteria | 2557 |
| 121 | Ga0466708_156375 | 3300042652 | Bacteria | 13181 |
| 122 | Ga0466727_186478 | 3300042655 | Bacteria | 5742 |
| 123 | Ga0466727_326095 | 3300042655 | Bacteria | 12039 |
| 124 | Ga0466706_239303 | 3300042599 | Bacteria | 4953 |
| 125 | Ga0466707_102884 | 3300042601 | Bacteria | 1856 |
| 126 | Ga0466707_153443 | 3300042601 | Bacteria | 1618 |
| 127 | Ga0466716_099267 | 3300042605 | Unclassified | 2120 |
| 128 | Ga0466716_339479 | 3300042605 | Bacteria | 2312 |
| 129 | Ga0466716_467705 | 3300042605 | Bacteria | 8879 |
| 130 | Ga0466719_119468 | 3300042606 | Bacteria | 3594 |
| 131 | Ga0456237_0016068 | 3300041968 | Bacteria | 1058 |
| 132 | Ga0466690_104561 | 3300042590 | Bacteria | 1353 |
| 133 | Ga0466691_036648 | 3300042593 | Bacteria | 19285 |
| 134 | Ga0466711_140978 | 3300042615 | Bacteria | 11630 |
| 135 | Ga0466711_266253 | 3300042615 | Bacteria | 5360 |
| 136 | Ga0466715_113268 | 3300042616 | Bacteria | 4247 |
| 137 | Ga0466726_061432 | 3300042619 | Bacteria | 1924 |
| 138 | Ga0466728_029479 | 3300042620 | Bacteria | 16859 |
| 139 | Ga0466735_162332 | 3300042624 | Bacteria | 1807 |
| 140 | Ga0466704_091542 | 3300042643 | Bacteria | 14323 |
| 141 | Ga0466704_105636 | 3300042643 | Bacteria | 29340 |
| 142 | Ga0466704_609277 | 3300042643 | Bacteria | 1728 |
| 143 | Ga0466709_292472 | 3300042648 | Bacteria | 2406 |
| 144 | Ga0466708_143925 | 3300042652 | Bacteria | 9438 |
| 145 | Ga0466708_340337 | 3300042652 | Unclassified | 2140 |
| 146 | Ga0466727_054426 | 3300042655 | Bacteria | 3305 |
| 147 | Ga0466705_111587 | 3300042612 | Unclassified | 2319 |
| 148 | Ga0466707_199364 | 3300042601 | Unclassified | 3616 |
| 149 | Ga0466707_341226 | 3300042601 | Bacteria | 4300 |
| 150 | Ga0466719_116376 | 3300042606 | Bacteria | 5682 |
| 151 | Ga0466719_116608 | 3300042606 | Bacteria | 2697 |
| 152 | Ga0466690_004435 | 3300042590 | Bacteria | 6624 |
| 153 | Ga0466690_190950 | 3300042590 | Bacteria | 13035 |
| 154 | Ga0466711_041478 | 3300042615 | Bacteria | 1399 |
| 155 | Ga0466711_126253 | 3300042615 | Bacteria | 12473 |
| 156 | Ga0466715_582732 | 3300042616 | Bacteria | 1970 |
| 157 | Ga0466723_018351 | 3300042618 | Unclassified | 4025 |
| 158 | Ga0466726_294966 | 3300042619 | Bacteria | 1747 |
| 159 | Ga0466728_052990 | 3300042620 | Bacteria | 2312 |
| 160 | Ga0466735_004333 | 3300042624 | Bacteria | 1612 |
| 161 | Ga0466704_035654 | 3300042643 | Unclassified | 2378 |
| 162 | Ga0466704_266901 | 3300042643 | Bacteria | 2118 |
| 163 | Ga0466704_385504 | 3300042643 | Bacteria | 2074 |
| 164 | Ga0466708_124028 | 3300042652 | Bacteria | 7248 |
| 165 | Ga0466727_080244 | 3300042655 | Bacteria | 1066 |
| 166 | Ga0466727_116927 | 3300042655 | Bacteria | 3279 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 72 | 253 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.