Protein Family IF04348
Metagenome
Isolate
137
Members
48
Samples
129
Scaffolds
478.14
Avg Length
Representative Sequence
- ID
- 3300041968|Ga0456237_0000577|Ga0456237_0000577_2339_4000
- Length
- 547 aa
- Sequence
- MFFFLALRNISKNKKNSGIVALLIAVITFLFFIGNSVIGRADRGIREVYTDNLTGDVVIQKAGDVTMNLFGANTPIIDTYFTIPVLPAHDAVMELAAAEPGIAGITSQVSGKAYLDMMEVREPVLLCGVDAASYFSIFPGITLEEGRFLRAGEYGAMITLDRAERIERQTGQRPAIGTPMLFTAGGNAGFKIREVPLVGIFSYQNPGQFMNEIVIIDPQTVRVLNSIQVAGGADVELGEETLRLLAADPDDVFDDAAIFAADMTDNAEFSADTLQAYLSEFDLSESDGEIGGDWNFIILRLEKGVSPGSFISALNKKLAAYGVTAVSWRIAAGTSAILLLLIQSLFNAGVFLVSVAGVIAAINILLVAVFRRTREIGTLRAIGASDAYIRILILLENFLIALAAGFAGILFGLCFLRFINRMGIIIPNDLIASLLGGAVLQVELSPHIAGLSVMVAVILGAAASVYPVEIAVRIEPMAAVXXXXRLSIRWKSRCGLSLWRRCGGDDGKVFCPFQAGDKIFIPLPAALCVSFGGTGFWFCFPQRRDVG
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
28.3%
Unclassified
17.4%
Rhinotermitidae
6.5%
Termopsidae
4.3%
Blaberidae
2.2%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 20 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 37 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 46 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 47 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_007263 | 3300042612 | Bacteria | 40751 |
| 2 | Ga0466707_325394 | 3300042601 | Bacteria | 1778 |
| 3 | Ga0264413_118676 | 3300024493 | Bacteria | 3027 |
| 4 | Ga0264413_138267 | 3300024493 | Bacteria | 2345 |
| 5 | Ga0123357_10189918 | 3300009784 | Bacteria | 2370 |
| 6 | AustNasuHG_c1001722 | 3300000089 | Bacteria | 7904 |
| 7 | AustNasuHG_c1002941 | 3300000089 | Bacteria | 6134 |
| 8 | Ga0072941_1023156 | 3300005201 | Bacteria | 7267 |
| 9 | Ga0072941_1038484 | 3300005201 | Bacteria | 5484 |
| 10 | Ga0466712_067544 | 3300042614 | Bacteria | 41898 |
| 11 | Ga0466718_043842 | 3300042617 | Bacteria | 9656 |
| 12 | Ga0466718_154969 | 3300042617 | Bacteria | 4084 |
| 13 | Ga0466728_382517 | 3300042620 | Bacteria | 4307 |
| 14 | Ga0466704_222603 | 3300042643 | Bacteria | 60546 |
| 15 | Ga0466727_304517 | 3300042655 | Bacteria | 8046 |
| 16 | Ga0466732_334362 | 3300042656 | Bacteria | 6080 |
| 17 | Ga0466700_196476 | 3300042600 | Bacteria | 1568 |
| 18 | Ga0466719_279369 | 3300042606 | Bacteria | 9954 |
| 19 | Ga0264413_104284 | 3300024493 | Bacteria | 9049 |
| 20 | Ga0456237_0000577 | 3300041968 | Bacteria | 5575 |
| 21 | Ga0466690_082295 | 3300042590 | Bacteria | 3319 |
| 22 | Ga0466691_039435 | 3300042593 | Bacteria | 20509 |
| 23 | AustNasuHG_c1000958 | 3300000089 | Bacteria | 10425 |
| 24 | AustNasuHG_c1010886 | 3300000089 | Unclassified | 3159 |
| 25 | Ga0072940_1004615 | 3300005200 | Bacteria | 8291 |
| 26 | Ga0072940_1004617 | 3300005200 | Bacteria | 6202 |
| 27 | Ga0466712_306462 | 3300042614 | Bacteria | 8550 |
| 28 | Ga0466718_154608 | 3300042617 | Bacteria | 2906 |
| 29 | Ga0466723_056745 | 3300042618 | Bacteria | 10718 |
| 30 | Ga0466731_263901 | 3300042622 | Bacteria | 3467 |
| 31 | Ga0466703_304504 | 3300042636 | Bacteria | 2810 |
| 32 | Ga0466709_403353 | 3300042648 | Bacteria | 14900 |
| 33 | Ga0466708_024501 | 3300042652 | Bacteria | 4521 |
| 34 | Ga0466732_042592 | 3300042656 | Bacteria | 6024 |
| 35 | Ga0466732_071295 | 3300042656 | Bacteria | 4503 |
| 36 | Ga0264413_105979 | 3300024493 | Bacteria | 7443 |
| 37 | Ga0466692_188035 | 3300042591 | Bacteria | 4821 |
| 38 | Ga0466693_224631 | 3300042592 | Bacteria | 9393 |
| 39 | Ga0466691_150092 | 3300042593 | Bacteria | 13824 |
| 40 | Ga0123353_10284374 | 3300010167 | Bacteria | 2537 |
| 41 | JGI24698J34947_10003004 | 3300002449 | Bacteria | 9142 |
| 42 | Ga0466712_029124 | 3300042614 | Bacteria | 12816 |
| 43 | Ga0466712_098031 | 3300042614 | Bacteria | 43056 |
| 44 | Ga0466715_028817 | 3300042616 | Bacteria | 9460 |
| 45 | Ga0466715_067011 | 3300042616 | Bacteria | 9228 |
| 46 | Ga0466715_246457 | 3300042616 | Bacteria | 9146 |
| 47 | Ga0466723_118108 | 3300042618 | Bacteria | 8565 |
| 48 | Ga0466723_213427 | 3300042618 | Bacteria | 16725 |
| 49 | Ga0466726_024971 | 3300042619 | Bacteria | 5276 |
| 50 | Ga0466703_151649 | 3300042636 | Bacteria | 6348 |
| 51 | Ga0466709_256871 | 3300042648 | Bacteria | 26995 |
| 52 | Ga0466708_284999 | 3300042652 | Bacteria | 28094 |
| 53 | Ga0466732_216647 | 3300042656 | Bacteria | 8635 |
| 54 | Ga0466707_414681 | 3300042601 | Bacteria | 6085 |
| 55 | Ga0466722_223293 | 3300042609 | Bacteria | 3111 |
| 56 | Ga0264413_104325 | 3300024493 | Bacteria | 24047 |
| 57 | Ga0264413_115040 | 3300024493 | Bacteria | 6159 |
| 58 | Ga0466694_214517 | 3300042594 | Bacteria | 32563 |
| 59 | Ga0466695_221990 | 3300042595 | Bacteria | 77793 |
| 60 | Ga0123353_10475176 | 3300010167 | Bacteria | 1831 |
| 61 | JGI24698J34947_10000132 | 3300002449 | Bacteria | 27417 |
| 62 | Ga0072941_1023157 | 3300005201 | Bacteria | 3353 |
| 63 | Ga0466715_410796 | 3300042616 | Bacteria | 6692 |
| 64 | Ga0466718_002524 | 3300042617 | Bacteria | 42896 |
| 65 | Ga0466718_041811 | 3300042617 | Bacteria | 20555 |
| 66 | Ga0466703_046739 | 3300042636 | Bacteria | 28227 |
| 67 | Ga0466703_229778 | 3300042636 | Bacteria | 8159 |
| 68 | Ga0466705_013545 | 3300042612 | Bacteria | 34726 |
| 69 | Ga0466705_324122 | 3300042612 | Bacteria | 22195 |
| 70 | Ga0466716_362076 | 3300042605 | Bacteria | 22472 |
| 71 | Ga0466720_178452 | 3300042607 | Bacteria | 61615 |
| 72 | Ga0466722_135992 | 3300042609 | Bacteria | 2372 |
| 73 | Ga0264413_112960 | 3300024493 | Bacteria | 13089 |
| 74 | Ga0466690_086451 | 3300042590 | Bacteria | 9224 |
| 75 | Ga0466691_047978 | 3300042593 | Bacteria | 9754 |
| 76 | Ga0123355_10001012 | 3300009826 | Bacteria | 38990 |
| 77 | JGI24698J34947_10009196 | 3300002449 | Bacteria | 5422 |
| 78 | JGI24698J34947_10017592 | 3300002449 | Unclassified | 3872 |
| 79 | JGI24700J35501_10929315 | 3300002508 | Bacteria | 9029 |
| 80 | Ga0072940_1017890 | 3300005200 | Bacteria | 10977 |
| 81 | Ga0072941_1101721 | 3300005201 | Bacteria | 5376 |
| 82 | Ga0466712_069703 | 3300042614 | Bacteria | 18452 |
| 83 | Ga0466712_096948 | 3300042614 | Bacteria | 13734 |
| 84 | Ga0466712_223592 | 3300042614 | Bacteria | 5084 |
| 85 | Ga0466711_142820 | 3300042615 | Bacteria | 35097 |
| 86 | Ga0466715_131531 | 3300042616 | Bacteria | 3277 |
| 87 | Ga0466715_133837 | 3300042616 | Bacteria | 11157 |
| 88 | Ga0466718_083674 | 3300042617 | Bacteria | 23117 |
| 89 | Ga0466732_009972 | 3300042656 | Bacteria | 4028 |
| 90 | Ga0466707_008155 | 3300042601 | Bacteria | 3541 |
| 91 | Ga0264413_100367 | 3300024493 | Bacteria | 29796 |
| 92 | Ga0466692_158416 | 3300042591 | Bacteria | 8550 |
| 93 | Ga0466699_013067 | 3300042597 | Bacteria | 13318 |
| 94 | JGI24698J34947_10004039 | 3300002449 | Bacteria | 7975 |
| 95 | JGI24698J34947_10004366 | 3300002449 | Bacteria | 7693 |
| 96 | JGI24698J34947_10019405 | 3300002449 | Bacteria | 3667 |
| 97 | Ga0072941_1009244 | 3300005201 | Bacteria | 10446 |
| 98 | Ga0072941_1171642 | 3300005201 | Unclassified | 5179 |
| 99 | Ga0466715_095569 | 3300042616 | Bacteria | 4794 |
| 100 | Ga0466718_036118 | 3300042617 | Bacteria | 4945 |
| 101 | Ga0466723_328083 | 3300042618 | Bacteria | 3197 |
| 102 | Ga0466726_346816 | 3300042619 | Bacteria | 19893 |
| 103 | Ga0466702_243783 | 3300042635 | Bacteria | 2510 |
| 104 | Ga0466703_401770 | 3300042636 | Bacteria | 10081 |
| 105 | Ga0466705_352169 | 3300042612 | Bacteria | 3426 |
| 106 | Ga0466716_517915 | 3300042605 | Bacteria | 12969 |
| 107 | Ga0466720_108024 | 3300042607 | Bacteria | 60869 |
| 108 | Ga0264413_105820 | 3300024493 | Bacteria | 10451 |
| 109 | Ga0264413_114720 | 3300024493 | Bacteria | 4172 |
| 110 | Ga0466690_121045 | 3300042590 | Bacteria | 74235 |
| 111 | Ga0466691_063439 | 3300042593 | Bacteria | 8495 |
| 112 | Ga0466691_185422 | 3300042593 | Bacteria | 12554 |
| 113 | Ga0123353_10488427 | 3300010167 | Bacteria | 1799 |
| 114 | AustNasuHG_c1002524 | 3300000089 | Bacteria | 6628 |
| 115 | JGI24698J34947_10001287 | 3300002449 | Unclassified | 13139 |
| 116 | Ga0466715_016153 | 3300042616 | Bacteria | 4931 |
| 117 | Ga0466704_077441 | 3300042643 | Bacteria | 25921 |
| 118 | Ga0466709_228858 | 3300042648 | Bacteria | 27396 |
| 119 | Ga0466732_028038 | 3300042656 | Bacteria | 10403 |
| 120 | Ga0264413_139567 | 3300024493 | Bacteria | 4832 |
| 121 | Ga0466694_034023 | 3300042594 | Bacteria | 6000 |
| 122 | Ga0123356_10042379 | 3300010049 | Bacteria | 4240 |
| 123 | Ga0072941_1021659 | 3300005201 | Bacteria | 6805 |
| 124 | Ga0466712_139760 | 3300042614 | Bacteria | 32143 |
| 125 | Ga0466718_075255 | 3300042617 | Bacteria | 21483 |
| 126 | Ga0466704_112416 | 3300042643 | Bacteria | 17765 |
| 127 | Ga0466708_111468 | 3300042652 | Bacteria | 8897 |
| 128 | Ga0466708_204572 | 3300042652 | Bacteria | 25955 |
| 129 | Ga0466708_332078 | 3300042652 | Bacteria | 12009 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02687 | FtsX | FtsX-like permease family | 350 | 476 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.