Protein Family IF04337
Metagenome
Metatranscriptome
Isolate
174
Members
62
Samples
160
Scaffolds
90.63
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_201838|Ga0415639_201838_1074_1391
- Length
- 105 aa
- Sequence
- VTENVAEMETSVETKAGEKTARVRSGKKEFVGMVKSDKMEKTIVVEVTDHKAHSKYKKIMKTTKKYKARDENNVCKIGDIVNIIESRPLAGTVHWALSDIVTKAK
Sample Types
Isolate
8.1%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
3.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Unclassified
23.3%
Kalotermitidae
20.0%
Termopsidae
5.0%
Rhinotermitidae
3.3%
Blaberidae
1.7%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 13 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 14 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 21 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 28 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 29 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 42 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 43 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 44 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 51 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 54 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 55 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 56 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 62 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1001243 | 3300000089 | Bacteria | 9172 |
| 2 | JGI24698J34947_10014234 | 3300002449 | Bacteria | 4331 |
| 3 | JGI24698J34947_10034584 | 3300002449 | Bacteria | 2643 |
| 4 | JGI24695J34938_10055500 | 3300002450 | Bacteria | 1712 |
| 5 | JGI24697J35500_11200478 | 3300002507 | Bacteria | 1667 |
| 6 | Ga0072940_1013300 | 3300005200 | Bacteria | 4911 |
| 7 | Ga0123356_10000598 | 3300010049 | Bacteria | 40012 |
| 8 | Ga0123356_11316769 | 3300010049 | Bacteria | 885 |
| 9 | Ga0123353_11116769 | 3300010167 | Bacteria | 1045 |
| 10 | Ga0123353_13331689 | 3300010167 | Bacteria | 512 |
| 11 | Ga0466715_298705 | 3300042616 | Bacteria | 1176 |
| 12 | Ga0466718_002578 | 3300042617 | Bacteria | 1040 |
| 13 | Ga0466702_336909 | 3300042635 | Bacteria | 1134 |
| 14 | Ga0466727_034002 | 3300042655 | Bacteria | 1317 |
| 15 | Ga0466690_424141 | 3300042590 | Bacteria | 11663 |
| 16 | Ga0466693_147121 | 3300042592 | Bacteria | 1302 |
| 17 | Ga0466699_002667 | 3300042597 | Bacteria | 1040 |
| 18 | Ga0466732_356414 | 3300042656 | Bacteria | 33050 |
| 19 | JGI24698J34947_10002678 | 3300002449 | Bacteria | 9608 |
| 20 | JGI24698J34947_10019985 | 3300002449 | Bacteria | 3609 |
| 21 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 22 | JGI24695J34938_10003263 | 3300002450 | Bacteria | 11475 |
| 23 | JGI24702J35022_10246791 | 3300002462 | Bacteria | 1037 |
| 24 | Ga0074263_111384 | 3300005485 | Bacteria | 1541 |
| 25 | Ga0123356_10303362 | 3300010049 | Bacteria | 1703 |
| 26 | Ga0123356_10446414 | 3300010049 | Bacteria | 1441 |
| 27 | Ga0123356_10466373 | 3300010049 | Bacteria | 1414 |
| 28 | Ga0123356_11260240 | 3300010049 | Bacteria | 904 |
| 29 | Ga0466712_144579 | 3300042614 | Unclassified | 1675 |
| 30 | Ga0466715_251451 | 3300042616 | Unclassified | 1110 |
| 31 | Ga0466715_369095 | 3300042616 | Bacteria | 13389 |
| 32 | Ga0466718_048123 | 3300042617 | Unclassified | 2274 |
| 33 | Ga0466731_052988 | 3300042622 | Bacteria | 4732 |
| 34 | Ga0466702_187491 | 3300042635 | Bacteria | 1245 |
| 35 | Ga0466704_113010 | 3300042643 | Bacteria | 47024 |
| 36 | Ga0466727_085776 | 3300042655 | Bacteria | 4677 |
| 37 | Ga0415639_201838 | 3300038395 | Bacteria | 1573 |
| 38 | Ga0466713_128250 | 3300042602 | Bacteria | 3709 |
| 39 | Ga0466716_058290 | 3300042605 | Bacteria | 1139 |
| 40 | Ga0466719_558857 | 3300042606 | Bacteria | 18938 |
| 41 | JGI24698J34947_10089648 | 3300002449 | Bacteria | 1415 |
| 42 | JGI24695J34938_10016184 | 3300002450 | Bacteria | 3803 |
| 43 | JGI24695J34938_10044908 | 3300002450 | Bacteria | 1963 |
| 44 | JGI24695J34938_10083843 | 3300002450 | Bacteria | 1314 |
| 45 | Ga0123356_10012663 | 3300010049 | Bacteria | 8175 |
| 46 | Ga0123356_10016206 | 3300010049 | Bacteria | 7119 |
| 47 | Ga0123356_11095683 | 3300010049 | Bacteria | 965 |
| 48 | Ga0123353_10534450 | 3300010167 | Bacteria | 1696 |
| 49 | Ga0466718_101830 | 3300042617 | Bacteria | 7468 |
| 50 | Ga0466728_124490 | 3300042620 | Bacteria | 6375 |
| 51 | Ga0466704_105194 | 3300042643 | Bacteria | 3233 |
| 52 | Ga0466709_309524 | 3300042648 | Bacteria | 19652 |
| 53 | Ga0466708_201728 | 3300042652 | Bacteria | 18881 |
| 54 | Ga0466727_121857 | 3300042655 | Bacteria | 3372 |
| 55 | Ga0223686_1026460 | 3300021244 | Bacteria | 1379 |
| 56 | Ga0233288_1052554 | 3300022232 | Bacteria | 1341 |
| 57 | Ga0466696_304127 | 3300042596 | Bacteria | 15419 |
| 58 | Ga0466700_402321 | 3300042600 | Bacteria | 7583 |
| 59 | Ga0466705_029843 | 3300042612 | Bacteria | 27393 |
| 60 | JGI24698J34947_10000296 | 3300002449 | Bacteria | 21653 |
| 61 | JGI24698J34947_10044455 | 3300002449 | Bacteria | 2274 |
| 62 | Ga0123356_10003877 | 3300010049 | Bacteria | 15570 |
| 63 | Ga0123356_10013675 | 3300010049 | Bacteria | 7820 |
| 64 | Ga0123356_10725548 | 3300010049 | Bacteria | 1163 |
| 65 | Ga0123356_13231268 | 3300010049 | Bacteria | 567 |
| 66 | Ga0123353_11014754 | 3300010167 | Bacteria | 1113 |
| 67 | Ga0466712_150408 | 3300042614 | Bacteria | 30693 |
| 68 | Ga0466723_029844 | 3300042618 | Bacteria | 15406 |
| 69 | Ga0466709_078322 | 3300042648 | Bacteria | 34193 |
| 70 | Ga0466693_123834 | 3300042592 | Bacteria | 16582 |
| 71 | Ga0466691_109493 | 3300042593 | Bacteria | 23172 |
| 72 | Ga0466699_163700 | 3300042597 | Bacteria | 58200 |
| 73 | Ga0466717_198742 | 3300042604 | Bacteria | 1428 |
| 74 | JGI24698J34947_10041657 | 3300002449 | Bacteria | 2364 |
| 75 | JGI24695J34938_10000518 | 3300002450 | Bacteria | 37542 |
| 76 | JGI24695J34938_10066675 | 3300002450 | Bacteria | 1516 |
| 77 | JGI24695J34938_10080729 | 3300002450 | Bacteria | 1343 |
| 78 | JGI24695J34938_10116982 | 3300002450 | Bacteria | 1085 |
| 79 | Ga0123356_10022307 | 3300010049 | Bacteria | 5980 |
| 80 | Ga0123356_10486677 | 3300010049 | Bacteria | 1388 |
| 81 | Ga0123356_12095234 | 3300010049 | Bacteria | 706 |
| 82 | Ga0123356_12948252 | 3300010049 | Bacteria | 594 |
| 83 | Ga0123356_13993400 | 3300010049 | Bacteria | 508 |
| 84 | Ga0123353_10473487 | 3300010167 | Bacteria | 1835 |
| 85 | Ga0123353_11291594 | 3300010167 | Bacteria | 948 |
| 86 | Ga0123353_12346127 | 3300010167 | Bacteria | 640 |
| 87 | Ga0466712_045447 | 3300042614 | Bacteria | 2234 |
| 88 | Ga0466712_094314 | 3300042614 | Bacteria | 3643 |
| 89 | Ga0466715_150441 | 3300042616 | Bacteria | 29649 |
| 90 | Ga0466718_051855 | 3300042617 | Bacteria | 3757 |
| 91 | Ga0466726_120322 | 3300042619 | Bacteria | 2297 |
| 92 | Ga0466724_67911 | 3300042649 | Bacteria | 1440 |
| 93 | Ga0466708_074840 | 3300042652 | Bacteria | 7841 |
| 94 | Ga0223674_1001745 | 3300021235 | Bacteria | 2635 |
| 95 | Ga0415639_007350 | 3300038395 | Bacteria | 2384 |
| 96 | Ga0415639_046126 | 3300038395 | Bacteria | 3367 |
| 97 | Ga0466690_399515 | 3300042590 | Bacteria | 3649 |
| 98 | Ga0466705_061533 | 3300042612 | Bacteria | 25186 |
| 99 | JGI24698J34947_10011206 | 3300002449 | Bacteria | 4922 |
| 100 | JGI24695J34938_10000751 | 3300002450 | Bacteria | 30457 |
| 101 | JGI24695J34938_10005680 | 3300002450 | Bacteria | 7703 |
| 102 | JGI24695J34938_10017150 | 3300002450 | Bacteria | 3659 |
| 103 | Ga0072940_1116529 | 3300005200 | Bacteria | 860 |
| 104 | Ga0072941_1023993 | 3300005201 | Bacteria | 10451 |
| 105 | Ga0123356_10513167 | 3300010049 | Bacteria | 1356 |
| 106 | Ga0123356_10842350 | 3300010049 | Bacteria | 1088 |
| 107 | Ga0466731_188985 | 3300042622 | Bacteria | 2025 |
| 108 | Ga0466731_259563 | 3300042622 | Bacteria | 1517 |
| 109 | Ga0466731_379414 | 3300042622 | Bacteria | 1690 |
| 110 | Ga0466702_229153 | 3300042635 | Bacteria | 1974 |
| 111 | Ga0466709_036113 | 3300042648 | Bacteria | 2961 |
| 112 | Ga0223688_1004354 | 3300021227 | Bacteria | 1468 |
| 113 | Ga0255786_1004416 | 3300022815 | Bacteria | 734 |
| 114 | Ga0466692_191986 | 3300042591 | Bacteria | 42335 |
| 115 | Ga0466694_213462 | 3300042594 | Bacteria | 29362 |
| 116 | Ga0466699_115193 | 3300042597 | Bacteria | 1541 |
| 117 | Ga0466700_232793 | 3300042600 | Bacteria | 2248 |
| 118 | Ga0466713_115057 | 3300042602 | Bacteria | 32652 |
| 119 | Ga0466719_019759 | 3300042606 | Bacteria | 2771 |
| 120 | Ga0466720_002020 | 3300042607 | Bacteria | 40222 |
| 121 | JGI24695J34938_10015988 | 3300002450 | Bacteria | 3831 |
| 122 | JGI24695J34938_10092523 | 3300002450 | Bacteria | 1240 |
| 123 | Ga0068302_10148556 | 3300005071 | Bacteria | 1000 |
| 124 | Ga0068305_10281239 | 3300005083 | Unclassified | 513 |
| 125 | Ga0072940_1006134 | 3300005200 | Bacteria | 5123 |
| 126 | Ga0123356_10000433 | 3300010049 | Bacteria | 47783 |
| 127 | Ga0123356_13694609 | 3300010049 | Bacteria | 529 |
| 128 | Ga0123354_10543091 | 3300010882 | Bacteria | 881 |
| 129 | Ga0466712_170294 | 3300042614 | Bacteria | 20783 |
| 130 | Ga0466715_127763 | 3300042616 | Bacteria | 5699 |
| 131 | Ga0466723_195578 | 3300042618 | Bacteria | 19421 |
| 132 | Ga0466726_107824 | 3300042619 | Unclassified | 1102 |
| 133 | Ga0466693_400992 | 3300042592 | Bacteria | 1101 |
| 134 | Ga0466732_430914 | 3300042656 | Unclassified | 1778 |
| 135 | JGI24695J34938_10000285 | 3300002450 | Bacteria | 49928 |
| 136 | JGI24695J34938_10004249 | 3300002450 | Bacteria | 9497 |
| 137 | JGI24695J34938_10005417 | 3300002450 | Bacteria | 7963 |
| 138 | JGI24695J34938_10118645 | 3300002450 | Bacteria | 1077 |
| 139 | JGI24695J34938_10443195 | 3300002450 | Bacteria | 586 |
| 140 | JGI24702J35022_10033929 | 3300002462 | Bacteria | 2730 |
| 141 | JGI24702J35022_10524811 | 3300002462 | Bacteria | 728 |
| 142 | Ga0123356_10013345 | 3300010049 | Bacteria | 7934 |
| 143 | Ga0123356_12145299 | 3300010049 | Bacteria | 698 |
| 144 | Ga0123353_10521300 | 3300010167 | Unclassified | 1724 |
| 145 | Ga0123353_10669070 | 3300010167 | Bacteria | 1465 |
| 146 | Ga0466712_018340 | 3300042614 | Bacteria | 7391 |
| 147 | Ga0466712_025186 | 3300042614 | Bacteria | 1422 |
| 148 | Ga0466731_231305 | 3300042622 | Bacteria | 2387 |
| 149 | Ga0466702_048347 | 3300042635 | Bacteria | 1564 |
| 150 | Ga0466709_305207 | 3300042648 | Bacteria | 3717 |
| 151 | Ga0466708_306858 | 3300042652 | Bacteria | 6593 |
| 152 | Ga0223684_1011775 | 3300021240 | Bacteria | 512 |
| 153 | Ga0415639_020079 | 3300038395 | Bacteria | 7266 |
| 154 | Ga0466692_122123 | 3300042591 | Bacteria | 2315 |
| 155 | Ga0466693_300561 | 3300042592 | Bacteria | 1898 |
| 156 | Ga0466694_078502 | 3300042594 | Bacteria | 33638 |
| 157 | Ga0466696_334108 | 3300042596 | Bacteria | 35042 |
| 158 | Ga0466716_393053 | 3300042605 | Bacteria | 12262 |
| 159 | Ga0466719_159849 | 3300042606 | Bacteria | 4804 |
| 160 | Ga0466722_190603 | 3300042609 | Bacteria | 17454 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00366 | Ribosomal_S17 | Ribosomal protein S17 | 32 | 97 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.